KEGG   Loxodonta africana (African savanna elephant): 100655563
Entry
100655563         CDS       T04351                                 

Gene name
SOST
Definition
(RefSeq) sclerostin
  KO
K16834  sclerostin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04310  Wnt signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100655563 (SOST)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100655563 (SOST)
SSDB
Motif
Pfam: Sclerostin DAN Cys_knot
Other DBs
NCBI-GeneID: 100655563
NCBI-ProteinID: XP_003414325
UniProt: G3UN23
LinkDB
Position
Unknown
AA seq 213 aa
MQLSLALCLVCLLMHAAFRVVEAQGWQAFKNDATEIIPELGEYPEPLPEPENNKTMNRAE
NGGRPPHHPFETKDPSEYSCRELHITRYVTDGQCRSAKPVTELVCSGQCGPARLLPNAIG
RGKWWRPNGPDFRCIPDRYRAQRLQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELK
DFGPEAARPQKGRKVRPRAGGAKTNQAELENAY
NT seq 642 nt   +upstreamnt  +downstreamnt
atgcagctatctctagctctgtgtctcgtctgcttgctgatgcatgcagccttccgtgtg
gtggaggcgcaagggtggcaggccttcaagaatgatgccacagaaatcatccccgagctg
ggcgagtatcctgagcccctgccggagcctgagaacaacaagaccatgaaccgggcagag
aacggagggcggcctccccaccatccctttgagaccaaagacccgtcggagtacagctgc
cgcgagctacatatcacccgctacgtgacggatgggcaatgccgcagcgccaagccggtg
accgagctggtgtgctccggccagtgcggcccggcgcgcctgctgcccaacgccatcggt
cgcggcaagtggtggcgccctaacgggcctgacttccgttgcatccccgaccgctaccgc
gcgcagcgcctgcagctgctgtgtcccggcggcgccgcaccgcgctcgcgcaaggtgcgc
ctggtggcctcttgcaaatgcaagcgcctcacccgcttccacaaccagtcggagctcaaa
gacttcgggcccgaggcggcgcggccgcagaagggccgcaaagtgcggccccgtgccggg
ggcgccaaaaccaaccaggccgagctggagaacgcctattag

DBGET integrated database retrieval system