KEGG   Loxodonta africana (African savanna elephant): 100655623
Entry
100655623         CDS       T04351                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1 isoform X3
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04218  Cellular senescence
lav04310  Wnt signaling pathway
lav04380  Osteoclast differentiation
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04921  Oxytocin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05135  Yersinia infection
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100655623 (NFATC1)
   04310 Wnt signaling pathway
    100655623 (NFATC1)
   04024 cAMP signaling pathway
    100655623 (NFATC1)
   04022 cGMP-PKG signaling pathway
    100655623 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100655623 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100655623 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    100655623 (NFATC1)
   04660 T cell receptor signaling pathway
    100655623 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    100655623 (NFATC1)
   04659 Th17 cell differentiation
    100655623 (NFATC1)
   04662 B cell receptor signaling pathway
    100655623 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100655623 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100655623 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100655623 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100655623 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100655623 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100655623 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100655623 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    100655623 (NFATC1)
   05161 Hepatitis B
    100655623 (NFATC1)
   05163 Human cytomegalovirus infection
    100655623 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100655623 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100655623 (NFATC1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100655623 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 100655623
NCBI-ProteinID: XP_010585391
LinkDB
Position
Unknown
AA seq 792 aa
MLIFFLPEHYSYASSGISSGLPLSTAHPALPAPCHDLQTSNPVISVLPSTGHPSGYGGTV
DSGPAGYFLPSGGTRPNGAPALESPRIEITSYLGLHHGSNPFFHDVEVEDTVPGARRAPS
TATLPLPGLEAYRDPTCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPK
TTDPEDGFPRGLGACNLLASPRHSPSTSPRASVTEESWLGPRGSRPSSPCNKRKYGLNGR
QPSCSPHPSPTPSPQGSPRVSVTDDTWLGNSTQYTSSAIVAAINALSTDSSLDLGDGVPV
KARKTTLEHTAAMALKVEPASEDPGTTPPAATFSPEEFPAFQHIRKGAFCDQYLSVPQAP
CPWVKPKPLSPASYMSPSLPALDWQLPPHSGPYELRIEVQPKSHHRAHYETEGSRGAVKA
SAGGHPIVQLHGYLENEPLTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSN
TKVLEILLLPENNMRAIIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPGG
RTLSLQVASNPIECSQRSAQELPLVEKQSTDSYLVVGGKKMVLSGHNFLQDSKVIFVEKA
PDGHHVWEMEAKTDREMCKPNSLVVEIPPFRNQRITSPVQVNFYVCNGKRKRSQYQHFTY
LPANVPIIKTEPTDDYEPAQTCGPMTQGLSPLSKPYYSQQLLLPPDPGACLVAGFTSCQQ
RSTVMSPPPSTSPKLHDLSSATYTKCSPSTGHSHLGLQQPAGGAPTTQEVPRSRAVPSSA
PHPSSHATLQPQ
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgctaatcttcttccttccagagcactacagctatgcatcctccggtatcagttctggc
ctaccactcagcacagcacaccccgcactgccagccccatgccatgacctacagacgtct
aaccccgtcatctccgtcctcccatcgacaggccacccctcgggctatgggggcacagtg
gacagtgggcccgccgggtacttcctgccctcaggtggcacccggcccaatggcgcccca
gccctggagagcccccgcatcgagatcacatcctacctgggcctgcaccatggcagcaac
ccattcttccatgacgtggaggtggaggacactgtccccggtgccaggcgggcaccctcc
acggccacactgcctctgcccggcctcgaggcctacagggaccccacctgcctgagcccg
gccagtagtctgtcctcccgcagctgcaactccgaggcctcctcctacgagtccaactac
tcgtacccctacgcctccccccagacgtccccctggcagtctccctgcgtgtcccccaag
accactgaccctgaggatggcttccctcgcggactgggggcctgcaacctgctggcctcg
ccacggcactcaccgtccacctcaccgcgggccagcgtcaccgaggagagctggctgggc
cctcgcggctcccggccctcctcgccctgcaacaagcgcaagtatggcctcaatggccgg
cagccgtcctgctcaccacacccctcgcccaccccgtccccgcagggctccccacgtgtc
agtgtcactgatgacacctggctgggcaactccacgcagtacaccagctcggccatcgtg
gcagccatcaacgccctgtccaccgacagctcgctggacctgggtgacggcgtgcccgtc
aaggctcgcaagacaacgctggagcacacagccgccatggcgctcaaggtggaaccagcc
agtgaggaccctggcaccaccccacctgccgccaccttctccccggaggagtttcctgcc
tttcagcacatccgcaagggcgccttctgtgaccagtacctgtcggtgcctcaggccccc
tgcccctgggtgaagccgaagcccctgtccccagcttcctacatgagcccgtccctgcct
gccctcgactggcagctgccgcctcactcaggaccgtacgagcttcggatcgaagtgcag
cccaagtcccaccacagggcccactatgagacggaagggagccggggggctgtgaaggcg
tcggccggaggacaccctatcgtgcagctacatggttacttggaaaatgagccgctcacg
ctccagctgttcattgggacggcggacgaccgcttgctgaggccccacgccttctaccag
gtccaccggatcacagggaagactgtctccaccaccagccatgaggctatcctctccaac
accaaagtcctagagatcctgctgctgccagagaacaacatgcgagcaatcatcgactgt
gccgggatcttaaagctcagaaactctgacatcgagcttcgaaaaggggagaccgacatt
gggaggaagaacacgcgcgtgaggctggtcttccgcgtccacatcccgcagcctggcggc
cggaccctgtccctgcaggtcgcgtccaaccccatcgaatgctcccagagatcagcccag
gagctgccgctggtagagaagcagagcacagacagctaccttgtggtaggcggcaagaag
atggtgctctctggacacaactttctgcaggactcaaaagtcattttcgtggagaaagca
ccagatggtcaccatgtctgggaaatggaagcaaaaactgacagagaaatgtgcaagcca
aactcgctggtggttgagatcccacctttccgcaaccagagaatcaccagcccggttcag
gtcaatttctacgtctgcaacggaaagaggaagagaagccagtaccagcacttcacctac
cttcctgctaatgttccaattataaaaacagagcccaccgatgattacgagcctgcgcaa
acctgtggaccaatgacccaaggactcagtcctctctcaaagccctactacagccagcag
ctcctgctgcctcctgatcctggtgcgtgccttgtggctggcttcacttcctgccagcag
agaagcactgtgatgtcacctccgcccagcacaagcccgaagctccacgacctttcttct
gccacttacaccaagtgcagccccagcacaggccacagtcacctcggactccagcagccc
gccggaggggcccccaccactcaggaagtgccaagatccagagctgtcccctcaagtgct
ccccatccgtcatctcacgccacgctgcagccgcagtaa

KEGG   Loxodonta africana (African savanna elephant): 100658037
Entry
100658037         CDS       T04351                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X2
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04218  Cellular senescence
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04625  C-type lectin receptor signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04921  Oxytocin signaling pathway
lav05135  Yersinia infection
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100658037 (NFATC3)
   04310 Wnt signaling pathway
    100658037 (NFATC3)
   04022 cGMP-PKG signaling pathway
    100658037 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100658037 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100658037 (NFATC3)
   04660 T cell receptor signaling pathway
    100658037 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    100658037 (NFATC3)
   04659 Th17 cell differentiation
    100658037 (NFATC3)
   04662 B cell receptor signaling pathway
    100658037 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100658037 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    100658037 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100658037 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100658037 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100658037 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    100658037 (NFATC3)
   05161 Hepatitis B
    100658037 (NFATC3)
   05163 Human cytomegalovirus infection
    100658037 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100658037 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100658037 (NFATC3)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100658037 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 100658037
NCBI-ProteinID: XP_003417083
LinkDB
Position
Unknown
AA seq 1067 aa
MTTANCGAHDELDFKLVFGEDGAPAPPPPGPRPADLEPDDRASIYIFNVDPPPSALNLPH
CLPHHGLPSHSSVLSPSFQLQGHKNYEGISEVPESKYSPLGGPKPFECPSIQITSISPNC
HQEIDAPEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGVGHSLSPRQS
PCHSPRSSITDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVASPGHS
PRGSVTEDTWLNASVHGGPGLGPTLFPFQYCLETDIPLKTRKTSEDQAAILPGKLELCSD
DQGNLSPSRETSIDDGLGSQYPLKKDLSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENSMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQTASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHI
VLEVPPYHNPTVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPV
PHPAQTQRSCSDPGHPHDSVLSAQRSLVCPVQQAYVSMVTSSHLPQLQCSDESAGKEQHM
MPSAVVHQAFHVTPTPPVGSSYQPMQTNVYNGPTCLPINAASSQEFDSVLFQQDAAVPSL
INLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVQTPPHLQSIGYHCSNVGQRSLSSPVADQ
VKRQSSPQLQPITYGPSHSGSATTASPAASHPLASSSLSGPPSPQLQPMPYQSPSSGTAS
SLSPASRMHSGQHPTQAQSTGQGGLTAPSTLICHSLCDTTSFSPDGATVSIKPEPEEQEP
NFATIGLQDITLDDDQFMSDLEHQPSGSAEKWPNHNELSCPAPFWRI
NT seq 3204 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtctttggcgag
gacggggcgccggcgccgccgcccccgggcccgcggcctgcagatcttgagccagatgat
cgtgcatccatttacatctttaatgtagatccacctccatctgctttaaacttgccacat
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctc
caaggtcacaaaaactatgaaggaatttctgaggttcctgaatctaaatatagcccatta
ggtggtcccaagccctttgaatgtccaagtattcaaattacatccatctctcctaactgt
catcaagaaatagatgctcctgaagatgacctacacataaatgacccagaaagggaatat
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcctaccgggagtct
tctcttagtcctagtcctgccagcagcatctcttctaggagctggttctcagatgcatct
tcttgtgagtccctttcacacatttatgatgatgtggactcggagttgaacgaagctgct
gcccgatttactcttggatcccctctgacttctcctggtggctctccaggaggctgccct
ggagaagaatcttggcatcaacagtatggagttggacactccttgtcacccaggcagtct
ccttgccattctcccagatctagtatcactgatgagaattggctgagccccaggccagcc
tcaggaccctcatcgaggcctacttccccctgtgggaaacggcggcactccagtgctgag
gtttgttacgctggctccctctcaccccatcactcaccagttgcttctcctggtcactcc
cccaggggaagtgtaacagaagatacctggctcaatgcttctgtccatggcggaccaggc
cttggccctacactttttccatttcagtactgtttagagactgatatccctctgaaaaca
aggaagacttctgaagatcaagctgccatactaccaggaaaattagagctctgttcagat
gaccaagggaatttatcaccatcccgggagacttcaatagatgatggccttggatctcag
taccctttaaagaaagatttatctggtgaccaatttctttcagttccttcaccttttacc
tggagcaaacctaagcctggccacacccctatatttcgcacatcttcattgcctccacta
gactggcctttaccaacacattttggacaatgtgaactgaaaatagaagtgcaacctaaa
actcatcatcgagcccattatgaaactgaaggtagccgaggggcagtaaaagcatctact
gggggacaccctgttgtgaagctcctgggttatagtgaaaaaccgataaatctacagatg
tttattggtacagcagatgaccgatatttacgacctcatgcattttaccaggtgcatcga
atcactgggaagactgttgctactgcaagccaagagataataattgctagcacaaaagtt
ctggaaattccgcttcttcctgaaaatagcatgtcagccagtattgactgtgcaggtatc
ttgaaactccgcaattcagatatagaacttcgaaaaggtgaaactgatattggcagaaag
aatactagagtacgacttgtgtttcgtgtacacatcccacagcccagtggaaaagtcctt
tctctgcagacagcttctatacctgttgaatgctcccagcggtctgctcaagaacttcct
catattgagaaatacagtatcaacagttgctctgtaaatggaggtcatgaaatgattgtg
actggatctaattttcttccagaatccaaaatcatttttcttgaaaaaggacaagatgga
cgacctcagtgggaggtagaagggaaaataatcagagaaaaatgtcaaggggctcacatt
gtccttgaagtccctccatatcataacccaacagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacaccagtt
ttgatgaaacaagaacacagagaagagattgacttgtcttcagttccatctttgcctgtt
cctcatcctgcccagacccagaggtcttgctcagatccagggcacccacatgatagtgtt
ctgtcagcacagagaagcttggtttgtcctgtccaacaagcatatgtatcaatggtaacc
tcatcccatctgccacagttacaatgtagtgatgagagtgctggtaaagaacagcatatg
atgccttctgcagtcgtgcaccaggcttttcatgtcacacctacgcctcctgtgggctct
tcctatcagcctatgcaaactaatgtgtacaatggaccaacttgtcttcctattaatgct
gcctctagtcaagagtttgattcagttttgtttcagcaggatgcagctgttcctagttta
ataaatcttggctgtcaaccactgtcatccataccatttcattcttcaaattcaggctca
acaggccatctcttagcgcacacacctcattctgtacagaccccacctcatctgcagtca
attggataccattgttcaaatgtaggacaaagatctctttcttctccagtggctgaccag
gtcaagaggcagtcttcccctcagttacaacctattacatatggtccttcacattcaggg
tctgctacaacagcttccccagcagcctctcatcccctggccagttcatcactttctggg
ccaccatctcctcagctacagcctatgccttaccagtctcctagctcaggaactgcctca
tcactgtctccagcctccagaatgcattctggacagcacccaactcaagcacaaagtaca
ggccagggaggtctcaccgcaccttcaaccttaatatgtcacagtttgtgtgatacaacc
tcattttcacctgatggggcaactgtgagcattaaacctgaacctgaagagcaggagcct
aactttgcaactattggtctacaggacatcactttagatgatgaccagtttatgtctgac
ttggaacaccagccatcaggttcagcagagaaatggcctaaccacaatgagctctcatgt
ccagctcctttctggagaatctag

KEGG   Loxodonta africana (African savanna elephant): 100672662
Entry
100672662         CDS       T04351                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04218  Cellular senescence
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04921  Oxytocin signaling pathway
lav05135  Yersinia infection
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100672662 (NFATC2)
   04370 VEGF signaling pathway
    100672662 (NFATC2)
   04022 cGMP-PKG signaling pathway
    100672662 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100672662 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100672662 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    100672662 (NFATC2)
   04660 T cell receptor signaling pathway
    100672662 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    100672662 (NFATC2)
   04659 Th17 cell differentiation
    100672662 (NFATC2)
   04662 B cell receptor signaling pathway
    100672662 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100672662 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    100672662 (NFATC2)
   04380 Osteoclast differentiation
    100672662 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100672662 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100672662 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100672662 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    100672662 (NFATC2)
   05161 Hepatitis B
    100672662 (NFATC2)
   05163 Human cytomegalovirus infection
    100672662 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100672662 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100672662 (NFATC2)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100672662 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 100672662
NCBI-ProteinID: XP_010597738
UniProt: G3TEU2
LinkDB
Position
Unknown
AA seq 926 aa
MDAPESQPDPDGGDAPGHEPGGSPQDEFDFSILFDYKYLNPIEEEPNAHKVVGPPSGLAY
PDEVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQNFLSPAKPAGASGLSPRIEITPSHE
LMQAGGSLRMRDSGLLVEQLPGPGAAASPRFTLPVPGFEGYREPLCLSPASSGSSASFIS
DTFSPCTSPCVSPNNGGPDDLCPQFQNIPANYYSPRTSPIMSPRTSLAEDSCLGRHSPVP
RPASRSSSPGAKRRHSCAEALVTPLPGASPQRSRSPSPQPLPHVAPQDDSARAAYPPTAG
SAVLMDALNSLAADSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHVYPAVEFLGPCEQEE
RRNSAPESILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPH
HRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRI
TGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKN
TRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILT
GQNFTAESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRSSVKVNFY
VINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPAHGGLGSQPYYPQHPMVAESPS
CLVATMAPCQQFRSGLSSPDACYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSVAD
AHRSVLVHAGSQGQSSALLHPSAANQQASPVIHYSPTNQQLRCGSRQEFQHILCCENFAP
STARPGQPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQN
LDQTYLDDVNEIIRKEFSGPPTRNQT
NT seq 2781 nt   +upstreamnt  +downstreamnt
atggacgccccggagtctcagcccgaccccgatggcggggacgccccaggccatgagccc
gggggcagcccccaggacgagttcgacttctccatcctcttcgactataagtatttgaat
cccatcgaagaagaaccgaatgcacataaggtcgtcggcccaccctccggactcgcgtac
cccgatgaagtcctggactatggcctcaagccatacagccccctcgccagtctctctggc
gagcccccgggccgattcggagagccggatagggtggggccccagaactttctgagcccg
gccaagccagcaggggcctcgggcctgagccctcggatcgagatcactccgtcccacgaa
ctgatgcaggcaggggggtccctccgcatgagagactctggccttctggtcgagcagctg
cccgggcccggcgcggccgccagcccgaggttcacgctgcccgtgcccggctttgagggc
taccgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttcatttcc
gacaccttctccccctgcacctcgccctgcgtctcgcccaataacggcgggcccgacgac
ctgtgtccccagtttcaaaacatccctgctaattattattcccccagaacttcgccaata
atgtcacctcgaaccagcctcgccgaggacagctgcctgggccgccactcgcccgtgccc
cgtccggcctcccgctcctcgtcgcctggtgccaagcggaggcattcgtgcgcagaggcc
ttggttaccccgctgcccggagcctcaccccagcgctcccggagcccctcgccacagccc
ttgcctcacgtggctccccaggacgacagcgcccgggctgcgtacccacccacagctggc
tctgccgtcctcatggatgctctgaacagccttgctgcagactccccgtgcgggatcccc
cccaagatgtggaagaccagccctgacccgtcgccagtgtctgctgccccatccaaggct
ggcctgccccgccacgtctacccggcagtggaattcctcgggccctgcgagcaggaggaa
aggagaaactcggccccagagtccatcttgctagtgccaccaacttggcccaagcaactg
gttcctgctattcccatctgcagcatcccagtgactgcgtccctccctccccttgagtgg
ccattgtccagccagtcgggctcctatgagctgcgaattgaggtgcagccaaagccgcat
caccgcgcccactatgagacagaaggcagccgcggggccgtcaaagcgccaactggcggc
caccctgtggtccagctccatggctacatggaaaacaagcctctggggcttcagatcttc
attgggactgccgatgagcggatcctcaagccccatgccttctaccaggtgcaccgtatc
acagggaagactgtcaccaccaccagctacgagaagatcgtgggcaacaccaaagtcctg
gagatccctctggagccaaaaaacaacatgagggcgaccatcgactgtgcgggaatcctg
aagcttaggaacgctgacatcgagctgcggaaaggcgagactgacattgggagaaagaac
acacgggtgcggcttgttttccgggtgcacatcccagagtccagtgggaggatcgtctcc
ttgcaaactgcatcaaaccccatcgaatgctcccagcgttctgcccacgagctgcccatg
gttgaaagacaagacattgacagctgcctggtctacgggggccagcagatgatcctcacg
ggacagaacttcacggccgagtccaaagtcgtgtttactgagaagaccacagatgggcag
caaatttgggagatggaagccacagtggataaagacaagagccagcctaacatgcttttt
gttgagatccctgagtatcggaacaaacacatcaggtcatccgtgaaggtcaacttctac
gtcatcaatgggaaaaggaaacggagtcagcctcagcactttacctaccacccagttcca
gccatcaagacggagcccactgatgagtatgaccccaccttgatctgcagccccgcccac
ggaggcctggggagccagccttactacccgcagcacccaatggtggccgagtccccctcc
tgcctcgttgccaccatggctccctgccagcagttccgctcagggctctcgtcccccgac
gcctgctaccagcagcagaacccagcggctgtcctctaccaacggagcaagagcctgagc
cccagcctgctgggctaccagcagccggccctcatggccgcccccctgtctgtcgcagac
gcccaccgctccgtgctggtgcacgccggctcccagggccagagctcggccctcctgcac
ccctccgcggccaatcagcaggcctcaccggtgatccactactcgcccaccaaccagcag
ctgcgctgcgggagccgccaggaattccagcacatcttgtgctgtgagaatttcgcaccc
agcaccgccaggccaggccagccaccggtcagtcaaggtcagagattaagcccgggttcc
taccccacagtcattcagcagcagaatgccaccagccaaagagccgccaaaaatggaccc
ccggtcagtgaccaaaaggaagtattacccgcaggagtgacaattaagcaggagcagaac
ctggaccagacctacttggatgacgtaaatgaaattatcaggaaggagttttcaggacct
cccaccagaaatcagacgtaa

KEGG   Loxodonta africana (African savanna elephant): 100676091
Entry
100676091         CDS       T04351                                 

Gene name
NFATC4
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04218  Cellular senescence
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04625  C-type lectin receptor signaling pathway
lav04921  Oxytocin signaling pathway
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100676091 (NFATC4)
   04022 cGMP-PKG signaling pathway
    100676091 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100676091 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100676091 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100676091 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    100676091 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100676091 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    100676091 (NFATC4)
   05161 Hepatitis B
    100676091 (NFATC4)
   05163 Human cytomegalovirus infection
    100676091 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100676091 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100676091 (NFATC4)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    100676091 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 100676091
NCBI-ProteinID: XP_010598852
LinkDB
Position
Unknown
AA seq 698 aa
MRRPPVRPGLPLPSPRASPRPWTPEDPWSLYGPSPGGRGPEDSWLLLSAPGPTPASPRPA
SPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPPPPLPLAREPGSPGPFDYVGAPPV
ESIPQKTRRTSSEQAVVLPRSEEPSPCNGKLPSGAEETAAPPGGSRKEVAGMDYLAVPSP
LAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELRIEVQPRAHHRAHYETEGSRGAVK
AAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHAFYQVHRITGKMVATASYEAVVSG
TKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQGSG
KVVSVQAASVPIECSQRSAQELPQVEAYSPSACSMRGGEELVLTGSNFLPDSKVVFIERG
PDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFKF
LPVIFKEEPLPDSSLRGFSSAPGPPFGTDMDFSPPRPLYPSYPHEDPAYETPYLSEGFSY
GTPPLYPQTGPPPSYRPGLRMFPDTGGTTGCARPPPVSFLPRPFPSDPYGGRGSPFPLGL
PFPPPAPFRPPLPSSPPLEGPFPSQSGVHSPPAEGYNEVGPGYGPGEGAPEQEKSRGGYS
SGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEPPA
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgaggcggcctccggttcggcctgggctcccgctgccctcaccccgggcctcgcctagg
ccgtggaccccggaagatccctggagcctgtacggtcccagcccaggaggccgggggcct
gaggatagctggctactcctcagcgcccctgggcccacccctgcctcgcctcggcccgcc
tctccatgtggcaagaggcgctattccagctcgggaaccccatcttctgcctccccagct
ctgtcccgccgtggcagcctgggggaggaggggcctgagccacctccaccacccccattg
cctctcgcccgggaacctggctcccctggtccatttgactatgtgggggccccaccggtt
gaaagcatcccccagaagaccagacggacttccagcgagcaggccgtggtcttgcctcgg
tctgaggagccttctccgtgcaatgggaagctgccatctggagcggaggagactgcagct
cctccagggggctccaggaaggaggtggctggcatggactacctggcagtgccgtcccca
ctcgcttggtccaaggcccggattgggggacatagtcctatcttcaggacctctgcctta
ccccccctggactggcctctgcccagtcagtatgagcagctggaactgaggattgaggtg
cagcctagagcccaccaccgggcccactatgagacagagggcagccgaggagctgtcaaa
gctgcccctggtggtcaccccgtggtcaagctcctaggctacagtgagaagccactgacc
ctacagatgttcattggtactgcagatgaaaggaaccttcggcctcatgctttctatcag
gtgcaccgaatcacgggcaagatggtagccacggccagctatgaagctgtagtcagtggt
accaaggtgttggagatgaccctgctccctgagaacaacatggcagccaacattgactgt
gctggaatcctgaagcttcggaattcagacattgagctgcgaaagggtgagacagacatc
ggacgcaagaacactcgagtgcggctggtgttccgggtacacgtgccccagggcagcggg
aaggtcgtctcagtgcaggcagcatcggtgcccatcgagtgctcccagcgctcggcccag
gagctgccccaggtggaggcctacagccccagtgcctgctccatgagaggaggcgaagaa
ctagtgctgactggctccaacttcctgccagactccaaggtggtgttcattgagaggggc
cctgatggaaagctgcaatgggaggaggaggccacggtgaaccggttgcaaagcaatgag
gtgacgctgaccctgacagtccctgagtacagcaacaagagggtgtcccgaccagtccag
gtctacttttatgtctccaatgggcggaggaagcgcagccccactcagagtttcaagttc
cttcctgtgatcttcaaggaggagcctcttccggattcatctctccggggcttctcctca
gcaccagggcccccctttggcactgacatggacttctcaccacccagacccctttacccc
tcctatccccatgaagaccctgcttacgaaactccttatctgtcagaaggcttcagctat
ggcacaccccctctgtacccccagactgggcccccgccatcctacagacctggcctgcga
atgttccctgacactgggggtaccacaggttgtgcccggccacctccagtctccttcctt
ccccgccctttccctagtgacccctatggaggacggggctccccttttcctctagggttg
ccattccctccaccagccccttttcggcccccactcccttcgtccccacctcttgaaggt
cccttcccttctcagagtggtgttcattctccccctgctgagggatacaatgaggtaggg
ccaggctatggccctggggagggggctccggagcaggagaaatccaggggtggctacagc
agcggcttccgagacagtgtccctatccagggtatcacgctggaggaagtgagtgagatc
attggccgagacctgagtggcttccctgcacctcctggagaagagcctcctgcctga

DBGET integrated database retrieval system