KEGG   Loxodonta africana (African savanna elephant): 100655719
Entry
100655719         CDS       T04351                                 

Gene name
SLC1A3
Definition
(RefSeq) excitatory amino acid transporter 1
  KO
K05614  solute carrier family 1 (glial high affinity glutamate transporter), member 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04721  Synaptic vesicle cycle
lav04724  Glutamatergic synapse
lav05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100655719 (SLC1A3)
   04721 Synaptic vesicle cycle
    100655719 (SLC1A3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100655719 (SLC1A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100655719 (SLC1A3)
   04147 Exosome [BR:lav04147]
    100655719 (SLC1A3)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   100655719 (SLC1A3)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of cortical neuronal cells
   100655719 (SLC1A3)
SSDB
Motif
Pfam: SDF Yip1 MT
Other DBs
NCBI-GeneID: 100655719
NCBI-ProteinID: XP_003408041
UniProt: G3TCP3
LinkDB
Position
Unknown
AA seq 542 aa
MTKSNGEEPKIGGRMERLQRGVRKRTLLAKKKVQNITKEDVKNYLFRNAFVLLTVTAVIV
GTILGFTLRPYKMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMHREGKIVQVTAADAFLDLIRNMFPP
NLVEACFKQFKTNYEKRSFKVPIQSNETLVGAVINNVSEAMETLTRIKEELVPVPGSVNG
VNALGLVVFSMCFGFVIGSMKEQGQALKDFFDSLNEAIMRLVAVIMWYAPLGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENIGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFE
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT
TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKSYQLIAQESENEKPLDSET
KM
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgactaaaagcaatggagaagagcccaagatcgggggacggatggagaggttgcagcga
ggagttcgtaaacgcacactcttggccaagaagaaagtgcagaacatcacaaaggaggat
gttaaaaattacctgtttcggaacgcctttgtgctgctgactgtcactgctgtcattgtg
ggtacaatccttggatttactctccgaccatacaagatgagctaccgggaagtcaagtac
ttctcttttcctggggaactcctcatgaggatgttacagatgctggtattgcctcttatc
atctccagtcttgtcacaggaatggcggccctagatagtaaggcatcagggaagatggga
atgcgagctgtagtctattacatgactacgaccatcattgctgtggtgattggcataatc
attgttatcatcatccatcctgggaagggcacaaaggaaaacatgcacagagaaggcaaa
attgtacaagtgacagctgcagacgccttcctggacttgatcaggaacatgttccctcca
aatctggtggaagcctgctttaaacagtttaaaaccaactatgagaagagaagctttaaa
gtgcctatccagtccaatgaaacgctcgtgggtgctgtgataaacaacgtgtcagaggcc
atggagacgctcacacgaatcaaagaggagctggtcccagttccaggatctgtgaatgga
gtcaacgccctggggctggttgtcttctccatgtgctttggttttgtgattggaagcatg
aaggagcaggggcaagccctgaaagacttctttgattctcttaatgaagccatcatgaga
ctggtagcagtgataatgtggtacgcccctcttggcatcctcttcctgattgcagggaaa
attgtagagatggaagacatgggagtgatcggggggcagcttgccatgtacacagtgaca
gtcatcgtcggcttactcattcacgcagtcattgtcctgccccttctctacttcttggta
acacgtaaaaacccttgggtttttatcggaggcttgctacaagcactcatcacagctctg
ggaacctcctcaagttctgccaccctacccatcaccttcaagtgcctggaggagaacatt
ggtgtggacaaacgcgtcaccagattcgtgctccctgtgggggccaccattaacatggat
ggcactgccctctatgaggccttggctgccattttcatcgcccaagtgaacaacttcgaa
ctgaactttggacagattattacaatcagcatcacagccacagctgccagtattggggct
gctgggattcctcaggcaggcctggtcaccatggtcatcgtgctgacatctgtggggctg
ccgaccgacgacatcacgctcatcattgctgtggactggttcctggaccgcctccgtact
accaccaacgtgctcggtgactcccttggagctggaattgttgagcacttatcacgacat
gaactgaagaaccgagatgtcgaaatgggtaactcagtgattgaagagaatgaaatgaag
aaatcgtatcagctgattgcccaagaaagtgaaaatgagaagcctttggacagtgaaacc
aagatgtag

KEGG   Loxodonta africana (African savanna elephant): 100672626
Entry
100672626         CDS       T04351                                 

Gene name
SLC1A2
Definition
(RefSeq) excitatory amino acid transporter 2 isoform X2
  KO
K05613  solute carrier family 1 (glial high affinity glutamate transporter), member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04721  Synaptic vesicle cycle
lav04724  Glutamatergic synapse
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100672626 (SLC1A2)
   04721 Synaptic vesicle cycle
    100672626 (SLC1A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100672626 (SLC1A2)
   05016 Huntington disease
    100672626 (SLC1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100672626 (SLC1A2)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC1: High-affinity glutamate and neutral amino acid transporter
   100672626 (SLC1A2)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 100672626
NCBI-ProteinID: XP_010590428
LinkDB
Position
Unknown
AA seq 552 aa
MPKQVEVRMHDSHLTSEEPTHRHLGLRLCDKLGKNLLLTLTVFGVILGAVCGGLLRLASP
IHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTV
IAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQ
TVTKKVLVAPQSDKEANATSAVVSLLNETVTEAPEETKMVIRKGLEFKDGMNVLGLIGFF
IAFGIAMGKMGEQAKLMVEFFNILNEIVMKLVIMIMWYSPLGIACLICGKIIAIKDLEVV
ARQLGMYMITVIVGLIIHGGIFLPLIYFLVTRKNPFSFFAGIFQAWITALGTASSAGTLP
VTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVS
LTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFG
AGIVYHLSKAELDSIDSQHQVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDE
CKVPFLDIETCI
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgcccaagcaggttgaagtgcgaatgcacgacagccacctcacctctgaggagcccacg
caccggcacctgggcctgcgcttgtgtgacaagctagggaagaatctactgctcacgctg
acagtgtttggtgtcatcctgggggcagtatgtggagggcttcttcgtttggcgtctcct
atccaccctgatgtggttatgttaatagccttcccaggggatatactcatgaggatgcta
aaaatgctcattctccctctaattatctccagcttaatcacagggttgtcgggcctggat
gctaaagccagtggccgcttaggcacaagagccatggtgtattacatgtccacaaccgtc
atcgctgctgtgctgggagtcatcctggtcttggccatccacccagggaatcccaaactc
aagaagcaactggggcctgggaagaagaatgatgaagtgtccagcctggatgccttccta
gacctaattagaaatctcttccctgaaaatcttgtccaagcctgttttcaacagatacaa
acagtgacaaagaaagtcctggtggcacctcagtcggacaaggaggccaacgcaaccagc
gccgtcgtctccctgctgaacgagactgtgactgaggcgcctgaggaaacgaagatggtc
atcaggaagggcctggagttcaaggacgggatgaatgtcttaggtctgatagggtttttc
attgcttttggcatcgccatggggaagatgggagagcaggccaagctgatggtggaattc
ttcaacattttgaatgagatcgtaatgaagttagtgatcatgattatgtggtactctcct
ctgggtatcgcctgcctaatttgtgggaagatcattgcaatcaaggacttggaggtggtt
gctaggcaactgggaatgtacatgataacggtgattgtgggcctcatcatccatgggggc
atctttctccccttgatttactttctagtgaccaggaaaaaccctttctccttttttgct
ggcattttccaagcatggatcactgccctgggtaccgcttccagtgctggaactttgccg
gtcaccttccgttgcctggaagaaaatctggggattgataagcgcgtgaccaggtttgtc
ctccctgtgggagcaaccattaacatggatggcacagccctttatgaagcagtggccgcc
atctttatagcccaaatgaatggtgttgtcctggacggaggtcagattgtgactgtgagc
ctcacagccaccctggcgagtgtcggtgctgccagcatccccagtgccgggctggtcacc
atgctcctcattctgacagctgtgggcctgccgacagaggacatcagcctgctggtagct
gtggactggctgctggacaggatgagaacttcagtcaatgttgtgggtgactcttttggg
gctggaattgtctatcacctctccaaggctgagctggattccattgactcccagcaccaa
gtgcatgaagacattgaaatgaccaagactcaatccatttatgatgacatgaagaaccac
agggaaagcaattctaatcaatgtgtctatgctgcacacaactctgtcatagtagatgag
tgcaaggtaccatttttggatatcgagacttgtatatag

DBGET integrated database retrieval system