KEGG   Loxodonta africana (African savanna elephant): 100655725
Entry
100655725         CDS       T04351                                 

Gene name
CPEB3
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 3 isoform X1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100655725 (CPEB3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100655725 (CPEB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100655725 (CPEB3)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100655725 (CPEB3)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     100655725 (CPEB3)
   mRNA cycle factors
    P-body specific factors
     100655725 (CPEB3)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1 zf-B_box
Other DBs
NCBI-GeneID: 100655725
NCBI-ProteinID: XP_023402691
LinkDB
Position
Unknown
AA seq 724 aa
MITLTITRLFFPVSAAQTMQDDLLMDKSKTQPQPQQQRQQQQPQPEPSAAEVPSTPLSSE
TPKPEDSSAVPALSPAAAPPAPNGPEKMQMESPLLPGLSFHQPPQQPPPPPQEPAAPGAS
LSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTFSPQIGLAQTQH
HQQPPPPPAPQPAQPAQPPQPQPPQQRRSPASPSQAPYAQRSAAAAYGHQPIMTSKPSSS
SAAAAAAAAAAASSASSSWSTHQSVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGVGVP
SPLNPISPLKKPFSSNVIAPPKFPRAAPLTSKSWMEDNAFRTDNGNSLLPFQDRSRPYDT
FNLHSLENSLMDMIRTDHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNI
MALNSRSSLFPFEDAFLDDSHGDQSLSSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDE
DEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLC
VSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYG
GVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQ
MCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVP
FRWS
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgatcacattgacaataacgcgtctcttttttcccgtttcagctgcccaaaccatgcag
gatgatttactgatggacaaaagcaaaacccagccccagccccagcagcagcggcagcag
cagcagccccagcccgagcccagcgcagccgaagtcccatccacgcccctctcttcagag
acccccaagccggaggacagcagcgcagtgccggccctcagccctgccgcggccccgccg
gcccccaacggccccgagaagatgcagatggaatcgccgctcctgccgggcttgagtttc
caccagccccctcagcagccgccgccgccgcctcaggagcccgcggctccgggcgcgtcg
ctgtcgccgtccttcggcagcacctggtccacaggcaccacgaacgcggtggaagacagc
ttcttccaggggatcaccccagtcaacgggaccatgctcttccagaacttcccgcaccac
gtcaacccagtcttcggaggcaccttctccccgcagatcgggctggcgcagacccagcac
caccagcagccgccgccgccgcccgcgccgcagccggcacagcctgcgcagcccccgcag
ccgcagcccccgcagcagcgtcggtcgccggccagccccagccaggcgccctacgctcag
aggagcgccgccgcggcgtatggtcaccagcccatcatgaccagcaagccgtcctcgtcc
tcggccgccgcggccgccgcagctgccgccgccgcctcgtccgcgtcgtccagctggagc
acgcaccagagcgtgaacgcggcctggagcgcgccgtccaacccgtggggcggcctgcag
gctggccgggaccctcgccgggcggtcggcgtgggcgtgggcgtgggcgtcggggtgcct
tcgccgctcaaccccatctcaccgctcaaaaagcccttctccagcaatgtgatcgcgccg
cccaagttcccccgcgcggctccgctcacctccaagtcctggatggaggataacgctttt
cggaccgataatgggaacagtctgttgccatttcaggaccggagtaggccctatgacact
tttaacttgcactcgttggagaactccttaatggatatgataaggactgatcatgagcct
ctgaaaggtaaacactaccctcccagtggcccaccaatgagtttcgctgatataatgtgg
aggaatcattttgcaggacgcatggggataaatttccatcatccaggaacagataatatt
atggcacttaacagtcgatcttctctctttccctttgaagatgccttcctggacgacagc
catggtgatcagtccttgtcatctggcttaagttctcccactcgctgtcaaaatggggaa
agagtggaacgctattctagaaaggtgtttgttggaggccttcctcctgatattgatgaa
gatgagatcactgccagttttcgcaggtttggacccctcgtggtagactggcctcacaaa
gctgaaagcaagtcctattttcctcctaaaggctatgcctttctgctgttccaggaggag
agctcagtacaagctttgatagatgcctgcctagaagaggatgggaaactgtacctgtgt
gtgtccagccccaccatcaaggataaaccggtgcaaattcgaccttggaacctaagtgac
agtgactttgtaatggatggttctcagcctttggaccccagaaaaactatctttgttggg
ggagttccacgaccccttcgagctgttgaactggcaatgatcatggaccgtttgtacggc
ggtgtctgctatgctggcatcgatacagacccagagctgaagtaccccaaaggtgctggc
cgcgtggcgttctccaatcagcagagttacattgcggccatcagtgctcgctttgtgcag
ctccaacacaatgacattgacaaacgggtggaagtgaagccatacgtgctggatgatcag
atgtgtgatgagtgccagggcacgcgctgtggtgggaagtttgccccgttcttctgtgcc
aacgtcacctgtctgcagtattactgcgaatactgctgggcgagcatacattctcgcgcc
gggcgggagttccacaaaccgctggtgaaggagggaggcgatcgccctcgccacgtcccc
ttccgctggagctga

KEGG   Loxodonta africana (African savanna elephant): 100659712
Entry
100659712         CDS       T04351                                 

Gene name
CPEB2
Definition
(RefSeq) LOW QUALITY PROTEIN: cytoplasmic polyadenylation element-binding protein 2
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100659712 (CPEB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100659712 (CPEB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100659712 (CPEB2)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100659712 (CPEB2)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     100659712 (CPEB2)
   mRNA cycle factors
    P-body specific factors
     100659712 (CPEB2)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1
Other DBs
NCBI-GeneID: 100659712
NCBI-ProteinID: XP_023405558
LinkDB
Position
Unknown
AA seq 863 aa
MRDFGFGLLQAAPLRSGSPGTPLSGGPYRPYAAGPAAATAPLPSATPFCPLSPPPLPVTG
FSEAASPFSIPLGCGRAGSSLASSSSPFPAHQQTMQDEPLPGLTQQPARPLSGAAAAEKL
PNHHPGGXTNAGVTHLLPSQDFKPSLYTPPRSASSAAAXRTSSPRDFSKQQQQQQLSSQK
RKEFSPPHLPHPPDSKPPPPPLHCLCRFSPPPPPPGPLLRSAQLAQRQPPHKAAAAAVPS
FPQPQHLPAAGISPRELASEAGAGGGRVRSPAPGRSGPVRRPAARLRRWGRGEPAAPGRS
GPVRSGPVRRPAAWSRDLRELSDDLTPGTVGGGSAGENRAAARGLELGRPCGRDVAGAFT
KALKAWSPGSVCSLRRRLMCFLQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNM
GIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVRS
SLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRL
SYPHPGTDNLLMLNARSYGRRRGRSSLFPIDDGLLDDGHSDQVGVLNSPTCYSAHQNGER
IERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEES
SVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGG
VPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQL
QHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAG
REFHKPLVKEGADRPRQIHFRWN
NT seq 2592 nt   +upstreamnt  +downstreamnt
atgagggacttcgggttcgggctgctgcaggccgccccgctccgcagcggcagccccggg
accccactcagcggcgggccgtaccgcccctacgccgcggggcctgccgcggccaccgcc
ccgctgccctctgccacgcccttctgcccgctctcgccgccgccgttgcctgtcaccggc
ttctcggaggccgcctcccccttctccatccccctcggctgcggccgcgcaggcagctcg
ctcgcttcctcttcctccccgttcccggcgcatcagcagaccatgcaggatgagccgctg
ccgggcctgacacagcagccggcgcggccgctctctggggcggcggccgcggagaaactc
cccaaccaccaccctggcggcngcacgaacgcgggtgtgacccacctcctcccctcccag
gacttcaaaccgagtctgtacaccccgcctcgctccgcttcctccgctgctgctnngcgc
acctcctccccgcgggacttcagtaagcagcagcagcagcagcagctgagcagccagaag
aggaaagagttcagccccccccaccttccccaccctccggactccaagccgccgccgccg
ccgctccactgcctctgccggttcagcccgccgccgccgccgcccgggccgctcctccgc
tcggcgcagctcgcccagcgccagccgccgcacaaagccgccgccgccgccgttcccagc
ttcccgcaaccgcagcaccttcccgccgcaggaatttcgccccgcgagctcgcctcagag
gccggagccggcggcgggcgggtccgctccccagcgcccggccggtccggtccagtcagg
cggccggcggcgcggctccgtcgctggggccggggtgagccggcagcgcccggccggtcc
ggtccggtccggtccggtccagtcaggcggccggcggcctggtcccgggacctgcgggag
ctgtcagatgacttgaccccgggaaccgtcggtggcggctcagcgggcgaaaaccgagcc
gccgcgcgagggctggagctggggcggccgtgcgggcgggacgtggctggggcttttaca
aaagcactgaaagcctggagtccgggatccgtgtgttcgctgaggagaagactaatgtgt
tttctccagcctcttctgaaacaatctccttggagcaaccatcagagcagtggctggggc
actggaagtatgtcctggggagcaatgcatggcagagatcatcgtagaactgggaacatg
ggaattccaggaactatgaatcagatatctccattgaagaaaccattttctggtaatgtc
atagcaccaccgaaatttactcgctctactccatcgctgactccaaaatcttggattgaa
gataatgtgttcagaacagacaacaatagtaatacactcttacccttacaggtgagatct
agtttgcagttgccagcttggggctcagattcactccaagatagttggtgcactgcagcc
gggacatccagaatagaccaggaccgaagtagaatgtatgacagtttgaacatgcactct
ttggaaaattcccttattgatattatgagagcggagcatgatcctcttaagggtcgattg
agctatccacacccagggactgacaatctgttgatgttaaatgcaaggagttatgggcga
agacgaggtcgttcttccctctttccgatagacgatggcttactggatgatggtcatagt
gatcaagttggtgttttaaattcacccacatgttattcagctcatcaaaatggagagcga
atagagcgcttctctcgaaaagtttttgttggtggtcttcctccagatattgacgaagat
gaaataacagctagcttcagaagattcgggcctttggtagtagactggcctcataaagca
gaaagcaagtcctattttccaccaaaaggctatgcattccttctctttcaagaagagagc
tcagttcaggcactaattgatgcatgtattgaagaagatggaaagctctatctatgtgtt
tctagccctactatcaaggacaagccagttcagatccgtccttggaatttaagtgacagt
gattttgtgatggatggttctcagcctttggatccccgaaaaacaatttttgttggaggt
gttcctaggccattaagggctgtggaacttgctatgataatggaccggctatatggtgga
gtttgttatgcaggaattgatacagatcctgagctaaaatacccaaaaggtgctggacga
gttgctttctctaatcaacagagctatattgctgccattagtgctcggtttgttcaactt
cagcacggcgatattgataagcgcgtggaggtaaagccatatgtgctagatgaccagatg
tgtgatgaatgccagggtgcacgctgtggtgggaaatttgctcctttcttttgtgccaat
gtcacttgtctgcaatattactgtgagttttgttgggcaaatatccactctcgtgcagga
cgtgagttccataagccattggtaaaggaaggtgctgatcgcccacgtcagatccacttc
cgctggaactaa

KEGG   Loxodonta africana (African savanna elephant): 100667643
Entry
100667643         CDS       T04351                                 

Gene name
CPEB4
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 4 isoform X1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100667643 (CPEB4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100667643 (CPEB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100667643 (CPEB4)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100667643 (CPEB4)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     100667643 (CPEB4)
   mRNA cycle factors
    P-body specific factors
     100667643 (CPEB4)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1
Other DBs
NCBI-GeneID: 100667643
NCBI-ProteinID: XP_010590937
LinkDB
Position
Unknown
AA seq 721 aa
MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSAGSAW
LFPAPATHNIQDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQG
DNSSENGSGKEKIRIESPVLTGFDYQEATGLGTSTQPLTSSASSLTGFSNWSAAIAPSSS
TIINEDASFFHQGGVPAASANNGALLFQNFPHHVSPGFGGSFSPQIGPLSQHHPHHPHFQ
HHHSQHQQQRRSPASPHPPPFTHRNAAFNQLPHLANNLNKPPSPWSSYQSPSPTPSSSWS
PGGGGYGGWGGSQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYARPSSAFAPKSW
MEDSLNRADNIFPFPDRPRTFDMHSLESSLIDIMRAENDSIKGRLNYSYPGSDSSLLING
QSSLFPMEDGFLDDGRGDQPLHTGLGSPHCFTHQNGERVERYSRKVFVGGLPPDIDEDEI
TASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSS
PTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVC
YAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYVLDDQLCD
ECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRW
N
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgggggattacgggtttggagtgctagtgcaaagcaatactgggaataaatctgctttt
ccagtcagattccatccacatctgcagcctccacaccatcaccaaaatgccacccccagc
cctgctgcttttataaataataacacagctgccaatggcagcagtgctgggtcagcttgg
ctctttcctgccccagccacccataacattcaggatgagatcttggggtcagaaaaagcc
aaaagtcagcaacaggaacagcaggaccctctggaaaagcagcagctctcccccagtcca
ggtcaggaagctggaatactgcctgaaacggagaaggcaaaatctgaagaaaatcaaggg
gacaattcttcagaaaatggcagtggaaaggagaaaataagaatcgaatcgccagtgttg
acagggttcgattatcaagaagccacggggctagggacttcgacccaacccttgacatct
agtgcatcgtctcttactgggttcagtaactggtcagcagcgatagcgccttcatcgtct
acaataatcaatgaagatgcaagtttctttcaccagggaggggtccctgctgcctcagcg
aataacggtgctctgttgtttcaaaattttccccatcatgtcagccctggtttcggaggc
agcttctcccctcagatcgggcccctgtcgcagcaccacccacatcaccctcatttccag
catcatcacagccagcatcagcagcaaaggaggtcgcctgccagtccccatcccccgcct
ttcacacacagaaatgctgcttttaaccagctgcctcatttggcgaataatcttaacaaa
cccccctctccatggagcagctaccagagcccctctccgacaccgtcttcttcctggagc
ccagggggtggtggatatggaggctggggaggctcccaaggccgagatcaccgcagaggg
ctgaatggaggaataacgcccctgaactccatctcacctttgaagaaaaattttgcaagc
aatcatattcagctccagaagtatgctcggcccagctctgcctttgctcccaaatcctgg
atggaagatagcttgaacagagctgacaacatttttccttttccggatcgcccccggacg
tttgacatgcactcactggagagctcactcattgacataatgagagctgaaaatgattcg
attaaaggtcgtctaaactattcatatccaggatccgatagctctctgcttattaatggt
cagtcgtcactgtttccaatggaagatgggttcttggatgatggccgtggggatcaacct
cttcatactggcctaggttcacctcactgcttcactcaccagaatggggaaagagtggaa
cgatattctcgcaaggtgtttgtgggcggattgcctcctgacattgatgaagatgagatc
acagctagttttcgtcgctttggccctttgattgtggattggcctcataaagcagagagc
aaatcctattttcctcctaaaggttatgcattcctgctatttcaagatgagagctctgtt
caggctcttattgatgcatgtattgaagaagatggaaaactctacctgtgcgtatcaagt
cccactatcaaggataagccagtacagattcggccttggaatctcagtgacagtgacttt
gtgatggatggttcacagccactggacccacgaaaaacaatatttgttggtggtgttcct
cgaccattacgagctgtggagcttgcaatgataatggatcggctgtatggaggtgtgtgc
tatgctgggattgatactgaccctgagctaaaatacccaaaaggagctgggcgagttgca
ttctctaatcaacagagttacatagctgctatcagcgcccgctttgttcagctacagcat
ggagagatagataaacgggtggaagttaagccatatgtcttggatgatcagctgtgtgat
gaatgtcagggggcccgttgtgggggaaaatttgctccatttttctgtgctaatgttacc
tgtctgcagtattactgtgaatattgctgggctgctatccactcccgtgctggcagggaa
ttccacaagcccctggtgaaggaaggcggtgaccgccctcggcatatttcattccgctgg
aactaa

KEGG   Loxodonta africana (African savanna elephant): 100667978
Entry
100667978         CDS       T04351                                 

Gene name
CPEB1
Definition
(RefSeq) cytoplasmic polyadenylation element-binding protein 1 isoform X1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04114  Oocyte meiosis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100667978 (CPEB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100667978 (CPEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100667978 (CPEB1)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100667978 (CPEB1)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     100667978 (CPEB1)
   mRNA cycle factors
    P-body specific factors
     100667978 (CPEB1)
SSDB
Motif
Pfam: CEBP1_N RRM_7 CEBP_ZZ RRM_1
Other DBs
NCBI-GeneID: 100667978
NCBI-ProteinID: XP_010592100
LinkDB
Position
Unknown
AA seq 486 aa
MLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSAQSSTHSVLSMLHKPL
GNVLGKPPLSFLPLDPLGADLMDKFPAPSVRGSRLDTRPILDSRSSSPSDSDTSGFSSGS
DHLSDLISSLRISPPLPFLSLTGGGPRDPLKMGVGSRMDQEQAALTAVTPSPTSTSKRWP
GASVWPSWDLLEAPKDPFSIEREARLHRQAAAVNEATCTWSGQLPPQNYKNPIYSCKVFL
GGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGYVYLVFELEKSVRALLQACS
HDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSRTVFVGALHGM
LNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKF
TKKVQIDPYLEDSLCHVCSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHGPLMRNQ
KNRDSS
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgcttttccccacctctgcgcaagaatcttcccgtggcctcccagatgcaaatgacttg
tgccttggcctgcagtccctcagtctgacaggctgggaccgaccctggagcacccaagac
tcagattcctcagcccagagcagcacacactcggtactgagcatgctccataaaccgctg
ggaaatgtcctgggaaaaccccccttgagcttcctgcctctggacccccttggggctgac
ttgatggacaagtttccagcaccctcagtgagaggatcccgtctggacacccggcccatc
ctggactcccgttctagcagcccctctgactcagacaccagtggcttcagctctggatca
gatcatctctcagatttgatttcaagccttcgcatttcccctcctctgcccttcctgtct
ctgacggggggtggtcccagagaccctttaaagatgggggtcggatcccggatggaccaa
gagcaagctgctctcactgcagtcacaccctccccaaccagtacatcaaagagatggcct
ggagcttctgtgtggccatcctgggaccttcttgaagctcccaaagaccccttcagcata
gaaagagaggcaaggctgcaccggcaagctgcagctgtgaatgaagccacttgtacctgg
agcggccagcttcctccccagaactacaagaaccccatctactcttgcaaggtgttccta
ggaggtgttccctgggatattacagaagctggattggttaacaccttccgtgtttttggc
tctttgagtgtggagtggcctggtaaggatggcaagcacccccggtgtcctcccaaaggc
tatgtgtatctggtctttgaactagagaagtctgtccgggccttgcttcaggcatgttct
catgacccgctgagcccagatggcctgagtgaatattatttcaagatgtccagccgaagg
atgcgctgcaaggaggtgcaggtgatcccctgggtcctggctgacagcaactttgtccgg
agcccgtctcagaggcttgaccccagcaggacagtgtttgtcggcgctctgcatgggatg
ctcaatgctgaggccctggcagccatcttgaatgacctatttggtggagtggtgtatgct
gggattgacacagataagcacaagtatcccattgggtctggtcgtgtgacttttaacaac
caacgcagttacctgaaagcagtcagtgcagcttttgtggagatcaaaaccaccaagttt
accaagaaggttcagattgacccctacctagaagactctctgtgtcacgtctgcagttct
cagcctggtcctttcttctgtcgagaccaggtctgcttcaagtacttctgccggagctgc
tggcactggcggcacagcatggagggcctgcgccaccacggcccactgatgcggaaccag
aagaaccgagactccagctag

DBGET integrated database retrieval system