KEGG   Loxodonta africana (African savanna elephant): 100655727
Entry
100655727         CDS       T04351                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04218  Cellular senescence
lav04270  Vascular smooth muscle contraction
lav04360  Axon guidance
lav04370  VEGF signaling pathway
lav04371  Apelin signaling pathway
lav04510  Focal adhesion
lav04540  Gap junction
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04613  Neutrophil extracellular trap formation
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05034  Alcoholism
lav05132  Salmonella infection
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100655727 (RAF1)
   04012 ErbB signaling pathway
    100655727 (RAF1)
   04014 Ras signaling pathway
    100655727 (RAF1)
   04015 Rap1 signaling pathway
    100655727 (RAF1)
   04370 VEGF signaling pathway
    100655727 (RAF1)
   04371 Apelin signaling pathway
    100655727 (RAF1)
   04630 JAK-STAT signaling pathway
    100655727 (RAF1)
   04068 FoxO signaling pathway
    100655727 (RAF1)
   04072 Phospholipase D signaling pathway
    100655727 (RAF1)
   04071 Sphingolipid signaling pathway
    100655727 (RAF1)
   04024 cAMP signaling pathway
    100655727 (RAF1)
   04022 cGMP-PKG signaling pathway
    100655727 (RAF1)
   04151 PI3K-Akt signaling pathway
    100655727 (RAF1)
   04150 mTOR signaling pathway
    100655727 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100655727 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    100655727 (RAF1)
   04218 Cellular senescence
    100655727 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100655727 (RAF1)
   04540 Gap junction
    100655727 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100655727 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100655727 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100655727 (RAF1)
   04625 C-type lectin receptor signaling pathway
    100655727 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    100655727 (RAF1)
   04660 T cell receptor signaling pathway
    100655727 (RAF1)
   04662 B cell receptor signaling pathway
    100655727 (RAF1)
   04664 Fc epsilon RI signaling pathway
    100655727 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    100655727 (RAF1)
   04062 Chemokine signaling pathway
    100655727 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100655727 (RAF1)
   04929 GnRH secretion
    100655727 (RAF1)
   04912 GnRH signaling pathway
    100655727 (RAF1)
   04915 Estrogen signaling pathway
    100655727 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    100655727 (RAF1)
   04917 Prolactin signaling pathway
    100655727 (RAF1)
   04921 Oxytocin signaling pathway
    100655727 (RAF1)
   04926 Relaxin signaling pathway
    100655727 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    100655727 (RAF1)
   04919 Thyroid hormone signaling pathway
    100655727 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    100655727 (RAF1)
   04916 Melanogenesis
    100655727 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100655727 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    100655727 (RAF1)
   04720 Long-term potentiation
    100655727 (RAF1)
   04730 Long-term depression
    100655727 (RAF1)
   04722 Neurotrophin signaling pathway
    100655727 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    100655727 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100655727 (RAF1)
   05206 MicroRNAs in cancer
    100655727 (RAF1)
   05205 Proteoglycans in cancer
    100655727 (RAF1)
   05230 Central carbon metabolism in cancer
    100655727 (RAF1)
   05231 Choline metabolism in cancer
    100655727 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100655727 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100655727 (RAF1)
   05212 Pancreatic cancer
    100655727 (RAF1)
   05225 Hepatocellular carcinoma
    100655727 (RAF1)
   05226 Gastric cancer
    100655727 (RAF1)
   05214 Glioma
    100655727 (RAF1)
   05221 Acute myeloid leukemia
    100655727 (RAF1)
   05220 Chronic myeloid leukemia
    100655727 (RAF1)
   05218 Melanoma
    100655727 (RAF1)
   05211 Renal cell carcinoma
    100655727 (RAF1)
   05219 Bladder cancer
    100655727 (RAF1)
   05215 Prostate cancer
    100655727 (RAF1)
   05213 Endometrial cancer
    100655727 (RAF1)
   05224 Breast cancer
    100655727 (RAF1)
   05223 Non-small cell lung cancer
    100655727 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100655727 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100655727 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    100655727 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100655727 (RAF1)
   05152 Tuberculosis
    100655727 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100655727 (RAF1)
   05161 Hepatitis B
    100655727 (RAF1)
   05160 Hepatitis C
    100655727 (RAF1)
   05164 Influenza A
    100655727 (RAF1)
   05163 Human cytomegalovirus infection
    100655727 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100655727 (RAF1)
   05165 Human papillomavirus infection
    100655727 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100655727 (RAF1)
   01522 Endocrine resistance
    100655727 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100655727 (RAF1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100655727 (RAF1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100655727 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 100655727
NCBI-ProteinID: XP_003409796
LinkDB
Position
Unknown
AA seq 648 aa
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRVIEDAIRSHSESASPSALSSSPNNL
SPTGWPQPKTPVPAQRERAPGPGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggttttggattcaaagatgcc
gtgtttgatggctccagctgcatctcccctacaatagttcagcagtttggctatcagcgc
cgggcgtcagatgatggcaaactcacagattcttctaagacaagcaacactatccgagtt
ttcttgccaaacaagcaaagaacagtggtcaatgtgcgaaatggaatgagcttgcacgac
tgccttatgaaagccctcaaagtgaggggcttgcaaccagagtgctgtgcagtattccga
cttctccatgaacacaaaggtaaaaaagcacgtttagattggaatactgatgctgcctct
ttgattggagaagaacttcaagtagatttcctggatcatgttcccctcacaacacacaac
tttgctcggaagacgttcctgaagcttgccttctgtgacatctgccagaagtttctgcta
aatggatttcgatgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacagctgttattgttcccaaattccact
gttggtgatagtggggtcccagcactaccttctttgacaatgcgtcggatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatactccacaccccatgccttcacgttt
aacacctccagcccctcttcagagggctcactgtcccagaggcagagatcgacgtccacg
cctaatgtccacatggtcagcaccaccctgcctgtggacagcagggtgatagaggatgca
attcgaagtcacagcgaatcagcctcaccttcagccctgtccagcagtcccaacaatctg
agcccaacaggctggccgcagcccaaaaccccggtgccggcacagagagagcgggcgcca
ggacctgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaattgaagccagtgaagtgatgctctctacccggatcgggtcaggatcattt
gggactgtttataagggcaaatggcatggagatgttgcagtaaagatcctcaaggtcgtt
gacccaacacctgagcagctccaggcctttaggaatgaagtggctgtcctgcgcaaaaca
cggcacgtgaacatattgctcttcatggggtacatgacgaaggacaacctggcgattgtg
acccagtggtgtgaaggcagcagcctctataaacacctgcatgtccaggagaccaagttt
cagatgttccagttgattgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggattg
acggtaaaaattggagattttggtttggcaacagtaaagtcacgctggagtggttctcag
caggttgaacaacccaccggctctgtcctgtggatggccccagaggtgatccggatgcag
gacaataacccattcagcttccagtctgatgtctactcctatggcattgtattgtatgag
ctgatgacgggggaacttccttactcacacatcaacaaccgggatcagatcatcttcatg
gtgggtcgagggtatgcctccccggatcttagtaagctatacaagaactgccccaaagca
atgaagaggctcgtagctgactgtgtgaagaaagttaaggaagaaaggcctcttttcccc
cagatcctgtcttccattgagctgctccagcactctctaccgaaaatcaaccggagtgct
tctgagccctccctgcaccgggcggcccacactgaggatatcaatgcctgcacgttgacc
acgtcccctagattgcctgtcttctag

KEGG   Loxodonta africana (African savanna elephant): 100664119
Entry
100664119         CDS       T04351                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04068  FoxO signaling pathway
lav04150  mTOR signaling pathway
lav04270  Vascular smooth muscle contraction
lav04510  Focal adhesion
lav04650  Natural killer cell mediated cytotoxicity
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04928  Parathyroid hormone synthesis, secretion and action
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05034  Alcoholism
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100664119 (BRAF)
   04012 ErbB signaling pathway
    100664119 (BRAF)
   04015 Rap1 signaling pathway
    100664119 (BRAF)
   04068 FoxO signaling pathway
    100664119 (BRAF)
   04024 cAMP signaling pathway
    100664119 (BRAF)
   04150 mTOR signaling pathway
    100664119 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100664119 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100664119 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100664119 (BRAF)
   04062 Chemokine signaling pathway
    100664119 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100664119 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100664119 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100664119 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100664119 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100664119 (BRAF)
   04720 Long-term potentiation
    100664119 (BRAF)
   04730 Long-term depression
    100664119 (BRAF)
   04722 Neurotrophin signaling pathway
    100664119 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100664119 (BRAF)
   05205 Proteoglycans in cancer
    100664119 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100664119 (BRAF)
   05212 Pancreatic cancer
    100664119 (BRAF)
   05225 Hepatocellular carcinoma
    100664119 (BRAF)
   05226 Gastric cancer
    100664119 (BRAF)
   05214 Glioma
    100664119 (BRAF)
   05216 Thyroid cancer
    100664119 (BRAF)
   05221 Acute myeloid leukemia
    100664119 (BRAF)
   05220 Chronic myeloid leukemia
    100664119 (BRAF)
   05218 Melanoma
    100664119 (BRAF)
   05211 Renal cell carcinoma
    100664119 (BRAF)
   05219 Bladder cancer
    100664119 (BRAF)
   05215 Prostate cancer
    100664119 (BRAF)
   05213 Endometrial cancer
    100664119 (BRAF)
   05224 Breast cancer
    100664119 (BRAF)
   05223 Non-small cell lung cancer
    100664119 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100664119 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100664119 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100664119 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100664119 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100664119 (BRAF)
   05160 Hepatitis C
    100664119 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100664119 (BRAF)
   01522 Endocrine resistance
    100664119 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100664119 (BRAF)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100664119 (BRAF)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100664119 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100664119
NCBI-ProteinID: XP_023394931
LinkDB
Position
Unknown
AA seq 735 aa
MIQLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVS
SSASTDTVTSSSSSSLSVLPSSLSVFQNPTDVSRTNPKSPQKPIVRVFLPNKQRTVVPAR
CGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
TTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVS
KFFEHHPIPQEEASLAETALPGSSPPAPPSDARGPQILTSPSPSKSIPIPQPFRPADEDH
RNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDAGSTTGLSATPPASLPGSLTNV
KALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYK
GKWHVPFVGLCPEPVIRQQQTDVCAGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVN
ILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSI
IHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNP
YSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRL
MAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPK
TPIQAGGYGEFAAFK
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgatccagttgacacaggagcacatagaggccctgctggacaagtttgggggggagcac
aacccaccatcaatctatctggaggcctatgaagaatacaccagcaagctagatgccctc
caacaaagagaacagcagctattggaatccctggggaacggaactgatttttctgtttct
agctctgcatcaacggacaccgttacatcttcttcctcctctagcctttcagtgctacct
tcatctctttcagtttttcaaaatcccacagatgtgtcacggaccaaccccaagtcacca
caaaaacctatcgttagagtcttcctgcccaacaaacagagaacagtggtacctgcacgg
tgtggtgtcacagtccgggacagcctgaagaaggcgctcatgatgagaggtctgatccca
gagtgctgtgccgtttacagaattcaagatggagagaagaaaccgattggctgggacact
gatatttcctggctgactggcgaggagttacatgtagaagtgttggagaatgttccactc
acaacacacaactttgtacggaaaacttttttcaccttagcattttgtgacttttgtcga
aagctgcttttccaaggtttccgctgtcagacatgtggttacaagtttcaccagcgttgt
agtacagaggttccgctgatgtgcgttaattacgaccaactggatttgctgtttgtctcc
aagttctttgaacaccacccaatcccgcaggaggaggcctccttagcagagacagcactg
cccggatcgtcccctcccgcacccccctcagacgctcgtgggccccaaattctcaccagt
ccgtctccttcaaaatccattccaattccacagcccttccgaccagcagatgaagatcat
cgaaatcagtttgggcagcgagaccggtcctcgtcggcccccaatgtgcatataaacaca
atagagcctgtcaatattgatgacttgattagagaccaagggtttcgtggtgatgcagga
tcaaccacaggtctgtctgcgacccctcccgcatcactccctggctcgctcactaatgtg
aaagccttacagaaatctcctggacctcagcgggaaaggaagtcctcgtcatcctccgaa
gacaggaatcgaatgaaaacgcttggtaggcgggattcaagtgacgactgggagattcct
gatgggcagatcacagttggacagagaatcggatctgggtcatttggaaccgtctacaag
ggcaagtggcatgttccatttgtaggtctttgtcctgaaccagtaattagacagcagcaa
acagacgtgtgtgcaggtgatgtggcagtgaagatgttgaatgtgacagcacccacacct
cagcagctacaggccttcaaaaatgaagtaggagtcctcaggaaaacacgacatgtgaat
atcctactcttcatgggctactcaacaaagccacagctcgccatcgtcacccagtggtgt
gagggctccagcttgtatcaccatctccacatcattgagaccaaatttgagatgatcaaa
ctcatagacattgcacgacagactgcacagggcatggattacttacacgccaagtcaatc
atccacagagacctcaagagtaataatatatttcttcatgaagacctcacagtaaaaata
ggtgattttggcctagccacagtgaaatctcgatggagtgggtcccatcagtttgaacag
ttgtctggatccattttgtggatggcaccggaagtaatcagaatgcaagataagaacccc
tatagctttcagtcagatgtgtatgcatttgggattgtcctgtatgaactgatgactgga
cagttaccttattcaaacatcaacaacagggaccagataatttttatggtgggacgagga
tacctgtctccagatctcagtaaggtacggagtaactgtccaaaagccatgaagagatta
atggcagagtgcctgaaaaagaaacgagacgagagaccactctttccccaaattcttgcc
tctattgagctgctggcccgctcattgccaaaaattcaccgcagtgcatccgaaccctcc
ttgaatcgggccggcttccaaacagaggattttagtctgtatgcttgtgcttctccaaaa
acgcccatccaggcagggggctacggagaatttgcagccttcaagtag

KEGG   Loxodonta africana (African savanna elephant): 100671404
Entry
100671404         CDS       T04351                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf isoform X3
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04068  FoxO signaling pathway
lav04270  Vascular smooth muscle contraction
lav04650  Natural killer cell mediated cytotoxicity
lav04720  Long-term potentiation
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04928  Parathyroid hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05034  Alcoholism
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100671404 (ARAF)
   04012 ErbB signaling pathway
    100671404 (ARAF)
   04068 FoxO signaling pathway
    100671404 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100671404 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100671404 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100671404 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    100671404 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100671404 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100671404 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100671404 (ARAF)
   04720 Long-term potentiation
    100671404 (ARAF)
   04730 Long-term depression
    100671404 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100671404 (ARAF)
   05205 Proteoglycans in cancer
    100671404 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100671404 (ARAF)
   05212 Pancreatic cancer
    100671404 (ARAF)
   05225 Hepatocellular carcinoma
    100671404 (ARAF)
   05226 Gastric cancer
    100671404 (ARAF)
   05214 Glioma
    100671404 (ARAF)
   05221 Acute myeloid leukemia
    100671404 (ARAF)
   05220 Chronic myeloid leukemia
    100671404 (ARAF)
   05218 Melanoma
    100671404 (ARAF)
   05211 Renal cell carcinoma
    100671404 (ARAF)
   05219 Bladder cancer
    100671404 (ARAF)
   05215 Prostate cancer
    100671404 (ARAF)
   05213 Endometrial cancer
    100671404 (ARAF)
   05224 Breast cancer
    100671404 (ARAF)
   05223 Non-small cell lung cancer
    100671404 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100671404 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100671404 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    100671404 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100671404 (ARAF)
   05160 Hepatitis C
    100671404 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100671404 (ARAF)
   01522 Endocrine resistance
    100671404 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100671404 (ARAF)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100671404 (ARAF)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100671404 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase C1_1 RBD Kinase-like zf-RING-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100671404
NCBI-ProteinID: XP_010596019
LinkDB
Position
Unknown
AA seq 572 aa
MSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTM
HNFVRKTFFSLVFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRHFYHSV
QDLSGVSRQHEAPSNHPLNELLTPLGPSLSTVSSRTQHRDPEHFFPAPANAPLQRIRSTS
TPNVHMVSTTAPTDSSLIQLTAQSFSTDAAGTRSGGDGAPRGNPSPASVSLGKKSPHSKS
PSEQRERKSLADDKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVA
VKVLKVAQPTAEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHL
HVADTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVK
TRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGS
RDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSL
PKIERSASEPSLHRTQADELPACLLSAARLVP
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgagtgtctacgactctctagacaaggcccttaaggtgcggggtctcaatcaagactgc
tgcgtggtctaccgactcatcaaggggcgaaagacggtcactgcctgggacactgccatt
gcccccctggatggcgaggagctcattgtcgaagtccttgaagatgtcccactgaccatg
cacaattttgtgcggaagacgttcttcagcctggtattctgtgacttctgtcttaagttt
ctgttccatggcttccgctgccaaacctgcggctacaaattccatcagcattgttcctcc
aaggtccccacagtctgtgtcgacatgagcaccaaccgccgacatttctaccacagtgtc
caggatttgtcaggagtctccagacagcacgaggctccctctaaccatcccctgaatgag
ctgctaacccccctgggtcccagcctttctactgtcagctcgcgcacccagcaccgcgac
cctgagcacttcttccctgccccggccaatgcccccctccagcgcatccgttccacgtcc
actcccaatgttcatatggtcagcaccacagcccccacagactccagcctcatccagctc
actgcccagagtttcagcactgatgctgctggtactagaagtggtggtgatggagccccc
cgggggaaccccagcccagctagcgtgtccttggggaagaagtctccacattccaagtca
ccttcagagcagcgggagcggaagtccttggctgatgacaagaagaaagtgaagaacctg
gggtaccgagattcaggctattactgggaggtgccacccagtgaagtgcagctgctgaag
aggattggaacgggctcatttggcactgtgtttcgtgggcggtggcatggtgatgtggct
gtaaaggtgctcaaggtggcccaacccacagctgagcaggcccaggccttcaagaatgag
atgcaggtgctcaggaagacacggcacgtcaacatcttgctgtttatgggcttcatgacc
cggccaggattcgccatcatcacacagtggtgtgagggctccagcctctaccaccatcta
catgtggctgacacacgcttcgacatggttcagctcatcgatgtggcccggcagactgcc
cagggcatggactacctccatgccaaaaacatcatccaccgagatctcaagtctaacaac
atcttcctacacgaggggctcacagtaaagattggtgacttcggcctggccacagtgaag
acgaggtggagtggagcccagcccttggagcagccctcgggctccgttctatggatggca
gctgaggtgatccggatgcaggacccgaacccctacagcttccagtcagatgtctacgcc
tacggggttgtgttgtatgagctcatgactggctcactgccttacagccacattggcagt
cgtgaccagattatctttatggttggccgtggctatctgtccccggacctcagcaaaatc
tccagcaactgccccaaggccatgcgtcgcctgctgtctgactgcctcaagttccagcgg
gaggagcgacccctcttcccacagatcctggccacgattgagctgctgcagcggtcactc
cccaagattgagaggagtgcctccgaaccgtccttgcaccgaacccaggctgatgagttg
cctgcctgcctactcagcgcagcccgccttgtgccttag

DBGET integrated database retrieval system