KEGG   Loxodonta africana (African savanna elephant): 100655811
Entry
100655811         CDS       T04351                                 

Gene name
MYH14
Definition
(RefSeq) myosin-14 isoform X1
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
lav04530  Tight junction
lav04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100655811 (MYH14)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100655811 (MYH14)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100655811 (MYH14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100655811 (MYH14)
   04147 Exosome [BR:lav04147]
    100655811 (MYH14)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100655811 (MYH14)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100655811 (MYH14)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ ADIP AAA_22
Other DBs
NCBI-GeneID: 100655811
NCBI-ProteinID: XP_023399073
LinkDB
Position
Unknown
AA seq 2009 aa
MAAVTMSVPGRKAPPRPGPVPEAAQPFLFTPQGPGGGSGPGSWPGGSGTSPQVEWTARRM
VWVPSELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTC
LNEASVLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIIEMYRGKKRHEVPPHVY
AVTEGAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRKEPGVPASAS
TISYGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLE
KSRAIRQAKDECSFHIFYQLLGGAGEQLQADLLLEPFSHYRFLTNGPSSSPGQERELLQE
TLESLRVLGFTHEEITSMLRVVSAVLQFGNIVLKKERNTDQATMPDNTAAQKLCRLLGLG
VTDFSRALLAPRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSP
RQGASFLGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWTF
LDFGLDLQPCIDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQRPRQ
LRDQADFSVLHYAGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGL
EQVNSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIIPNHEKRAGKL
EPRLVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEKM
IQALELDPNLYRVGQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAARGYLARRAFQKRQ
QQQSALRVMQRNCAAYLKLRHWQWWRLFTKVKPLLQVTRQDEVLQARAQELQKVQELQQQ
SARQVGELQDRLAQLEEERTRLAEQLRAEAELCSEAEEMRGRLAARKQELELVVTELETR
VGEEEECSRQLQTEKKRLQQHIQELETHLEAEEGARQKLQLEKVTTEAKLKKFQEDLLHL
EDQNAKLGKERKLLEERLAEFSSQATEEEEKVKSLNKLRLKYEATIADMEDRLRKEEKGR
QELEKLKRRMDGESSELQEQMVEHKQRAEELRVQLDRKEEELQAALARAVEEGGARAQLL
KSLREAQAGLAESQEDLEAERAARAKAEKQRRDLGEELEALRSELEDTLDSTNAQQELRS
KREQEVTELKKALEEETRTHEVAVQELRQRHGQALGELAEQLEQARRGKSVWEKTRMSLE
AEVSELRAELSSLQSTRQESEQRRRRLESQLQEVQGRAGDGERARVEAAEKLQRAQAELE
NVSGALSEAESRAIRLSKELSSTEVQLHDAQELLQEETRAKLALGSRVRALESEATGLRE
QLEEEAAARERAGRELQAAQAQLSEWRRRQEEEAGALEAGEEARRRVAREAEALTQRLAE
KTEAVERLDRGRRRLQQELDDATMDLEQQRQLVSTLEKKQRKFDQLLAEEKAAVLRVVEE
RERVEAEGREREARALALTRALEEEQEAREELERQNRALRAEMEALLSSKDDVGKSVHEL
ERARRVAEQAASDLRTQVTELEDELTAAEDAKLRLEVTMQALKAQHERDLQGHDEAGEER
RRQLAKQLRDAEVERDEERKQRALAVATRKKLEAELEELKAQMETAGQGKEEAVKQLRKM
QTQMKELWREVEESRTSREEIFVQNRESEKRLKGLEAEVLRLQEELAASDRARRQAQQER
DEMADEVASGNLGKAAILEEKRQLEGRLGQMEEELEEEQSNAELVNDRYRKLLLQVETMT
TELSAERSFSAKAESGRQQLERQIQELRGRLGEEDAGARARQKMVIAALESKLAQAEEQL
EHESRERILSGKLVRRAEKRLKEVVLQVEEERRVADQLRDQLEKGNLRLKQLKRQLEEAE
DEASRAQAGRRRLQRELEDVTESAESMNREVTTLRNRLRRGPLTFTTRTVRQVFHLEEGV
ASDEEAEEAEPGAGAPHPESDGPVQAPPQ
NT seq 6030 nt   +upstreamnt  +downstreamnt
atggcagcagtgacgatgtctgtgccaggccggaaggcgccccccaggccgggcccagtg
cccgaggctgcccagccgttcctgttcacgccccaagggccgggcgggggtagcgggcct
ggcagttggccagggggctcgggtacctcgccgcaggtagagtggacggcccggcgcatg
gtgtgggtgccttcggagctccatgggttcgaggcagcagcgctgagggatgagggagag
gaggaggcggaggtggagctggcggagagcgggcggcggctgcggcttccgagggaccag
atccagcgcatgaacccgccgaagttcagcaaggccgaagacatggcggaactgacctgc
ctcaacgaggcctcggttctgcacaacctccgcgagcgatactattcaggcctcatctat
acatactctggccttttctgtgtggtcatcaacccatacaagcagcttcccatctatacg
gaggccatcatagagatgtaccggggcaagaaacgccacgaagtgccaccccacgtgtac
gcagtgactgagggggcctaccgaagcatgctccaggatcgtgaggatcagtccattctg
tgcactggggagtctggagctgggaagacagaaaacaccaagaaggtcattcagtacctt
gcccatgtggcgtcatccccaaagggccggaaggagccaggtgtccctgcctccgccagc
accatatcttatggtgagctggagcggcagctccttcaagccaatcccatcctggaggcc
tttggtaacgccaagacagtgaagaatgacaactcttctcgattcggaaaattcattcgc
atcaactttgatgttgctgggtacattgtgggcgccaacatcgagacctatttgctggag
aagtctcgggctattcgccaggccaaggatgaatgcagcttccatatcttctaccagctg
ctagggggcgccggagagcagctccaggccgaccttctcctggagccattttcccactac
cgcttcctgaccaacggcccatcgtcctctcctgggcaggagcgggagctcttgcaggag
acgctggagtccctgcgggtcctgggattcacccatgaagaaatcacctccatgctgcgg
gttgtctcagccgttctccagtttggcaacatcgtcctaaagaaagaacggaacaccgat
caagccaccatgcccgacaacacagctgcgcagaaactctgccgcctcctgggactggga
gtgacggatttctcccgcgccctgctcgccccccgcatcaaagttggccgagactatgtg
cagaaagcccagaccaaggagcaggctgactttgcactggaggccctggccaaggccacc
tacgagcgtctcttccgctggctggtgctgcgtctcaaccgtgccctggaccgcagcccc
cgccagggtgcctcctttctcggcatcctagacatcgctggcttcgagatcttccagctg
aactccttcgagcagctctgcatcaactacactaacgagaagctgcagcagctcttcaac
cacaccatgttcgtgctggagcaggaggagtaccagcgcgagggcatcccctggaccttc
ctcgactttggccttgacctgcagccctgcatcgacctcatcgagcgtccggccaacccg
cctggactcctggccctgctggatgaggaatgctggttcccaaaggccactgacaagtcc
tttgtggagaaggtggcccaggagcaaggtggccaccccaagttccagcggccgcggcaa
ctgcgggaccaggctgacttcagtgtcctgcactatgcgggcaaggttgactacaaggcc
aatgagtggctgatgaaaaacatggaccctctgaacgacaacgtcgcagccctgcttcac
caaagcacagaccggctgacagcggagatctggaaagatgtggaggggattgtgggactg
gagcaggtgaacagccttggagatggcccacccggtggccgtccccgccgaggcatgttc
cggacagtgggacagctctacaaggagtccctgagccgcctcatggccacgctcagcaac
accaaccccagcttcgtccgctgcatcatccccaaccacgagaagagggctggaaagctg
gagccccggctagtgctggaccagctccgttgtaacggcgtcctggaaggcattcgcatt
tgtcggcagggctttcccaaccgcatcctcttccaggagttccggcagcggtatgagatc
ctgacacccaatgccatccccaagggctttatggatgggaagcaggcctgtgagaagatg
atccaggccctggaactggaccccaacctctaccgtgtggggcagagcaagatcttcttc
cgggctggggtcctggcccagctggaagaggagcgggacctgaaggtcacagacatcatt
gtgtccttccaggcagctgcccggggatacctggcccgcagagccttccagaagcggcag
cagcagcagagtgccctgagggtgatgcagcggaactgcgcagcctacctgaagctgaga
cactggcaatggtggcggctcttcaccaaggtgaagccgctgctgcaggtgacccggcag
gacgaggtgctgcaggcgcgggcccaagagctgcagaaagtgcaggagctgcagcagcag
agcgcccgccaggtgggcgagctccaggaccggttggcgcagctggaggaggagcgcacc
cgcctggcggagcagctgcgggcagaggcggagctctgcagtgaggctgaggagatgcgg
gggcggctggcggcccgcaagcaggagctggaactggtggtgaccgagctggagacccgc
gtgggggaggaggaggagtgtagccgccagctccagacggagaagaagaggctgcagcag
cacatacaggagctggagacccacctggaggctgaggagggagcacggcagaagctgcag
ctggagaaggtgacaacagaggcaaagctgaagaagttccaggaggacctgctgcacttg
gaagatcagaatgccaagctcggcaaggaacggaagctgctggaggaacgtctggctgag
ttctcatcccaggcgactgaagaggaggagaaggtgaagagcctcaataaactacggctc
aaatacgaggccacgattgcagacatggaagaccgcctacggaaggaggagaagggccgc
caggaactggagaagctgaagcggcggatggacggcgagagctcggagctgcaggagcag
atggtggagcataagcagcgggcagaggagctgcgggtccagctggaccgcaaggaggag
gagctgcaggcagccctggccagagcggtggaggaaggtggggcgcgagcccagctgctg
aaatccctacgggaggctcaggcaggactggccgagtcccaggaggacctggaggcggag
cgcgcagccagggccaaggcagagaagcagcgccgggacctgggtgaggaattggaggca
ctgcggagtgaactggaggacacgctagactccaccaacgcacaacaggagctccgatcc
aaaagggaacaggaagtgacagagttgaagaaggctctggaggaggagacaagaactcac
gaggtggcggtgcaggagctgaggcagcgccatggccaggccctgggggagctggcagag
cagctggagcaggcccggaggggcaaaagtgtgtgggagaagacccggatgtccctggaa
gccgaggtgtccgagctacgggcagagctgagcagcctgcagagcacaaggcaggagagt
gagcagcggaggcgccgcctggagtcccagctgcaggaggtccagggccgggccggtgac
ggggagcgggcacgggtggaggctgccgagaagctgcagcgagcccaggctgagctggag
aatgtatctggggcactgagcgaggccgagtccagagccatcaggctgagcaaggagctg
agcagcaccgaggtccagctgcacgatgcccaggaactgctacaggaggaaaccagggcg
aagctggccttggggtcccgggtgcgagccctggagtctgaagccactggcctgcgggag
cagctggaggaggaggcagctgccagggaacgggcggggcgggagctacaggcagcccag
gcccagctctcagagtggcggcggcgccaggaggaggaagcaggggcactggaggcaggg
gaggaggcacggcgccgtgtagcccgtgaggctgaggctctgacccagcgcctggcagaa
aagacagaggcagtggagcggctggatcggggccgccgccggctgcaacaggaactggac
gatgccaccatggatctagagcaacaacggcagctcgtgagcacactggagaagaagcag
cgcaaattcgaccagctcctggcagaggagaaggcagctgtactgcgagtggtggaggaa
cgtgaacgggtcgaggcagagggccgggaacgtgaggctcgggccctggcactgacacgg
gccctggaggaggaacaggaggcacgtgaggagctggaacggcagaaccgggcactgcgg
gccgaaatggaggcactgctgagcagcaaggatgacgtcggcaagagtgtacatgagctg
gaacgagcccgccgggtggcagaacaggcagccagcgacctgcgaacacaggtgacagag
ctggaggatgagctgacagcagctgaggacgccaagctgcgcctagaggtgacaatgcag
gctctcaaggcacagcacgagcgggacctgcagggccacgatgaggctggtgaagagagg
cgccggcaattggccaagcagctgagggacgctgaggtggagcgggatgaggagcggaag
cagagggccctggctgtggccacccgcaagaagctggaagcagagctggaggagttgaag
gctcagatggagaccgctgggcagggcaaggaggaggccgtgaagcagcttcgcaagatg
cagacccagatgaaggagctatggcgggaggtggaggagtcacgcacctcccgggaggag
atttttgtccagaaccgcgaaagcgagaagcgtctgaaggggctggaggccgaggtgctg
cgactgcaggaggaactcgctgcctcggaccgcgcccggcgtcaagcccagcaggagcgg
gatgagatggcggatgaggtggccagtggcaaccttggcaaggcagccattctggaggag
aagcgtcagctggaggggcgcctagggcagatggaagaggaactggaggaggagcagagc
aacgcagagctcgtcaatgaccgctaccgaaagctcctcctacaggtggagacaatgacc
acagagttgtcagctgagcgcagtttctcagccaaggcagaaagtgggaggcagcagctg
gagcggcagatccaggaactacgggggcgcctgggtgaggaggacgctggggcccgggcc
cgccagaagatggtcatcgctgcccttgagtctaagctggcccaggctgaggagcagcta
gagcatgagagcagggagcgcatcctctcaggcaagctggtacgcagagctgagaagcgg
ctcaaagaggtggtgctccaggtggaggaggagcggagggtggctgaccagctccgggac
cagctggagaagggaaacctccggttgaagcagctgaagcgacagctggaggaggctgag
gatgaggcctcccgggcccaggcaggccgccggaggctgcagcgggagctggaggatgtc
actgagtcggctgaatccatgaaccgcgaggtgaccacgctgaggaatcggctccgacgc
ggccccctcaccttcaccacccgcactgttagacaggtcttccacctggaggaaggtgtg
gcatcggatgaagaggctgaggaggcagagccaggggctggggccccacacccagagtcg
gatgggcccgtgcaggccccaccccagtga

KEGG   Loxodonta africana (African savanna elephant): 100668402
Entry
100668402         CDS       T04351                                 

Gene name
MYH11
Definition
(RefSeq) myosin-11
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
lav04530  Tight junction
lav04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100668402 (MYH11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100668402 (MYH11)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100668402 (MYH11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100668402 (MYH11)
   04147 Exosome [BR:lav04147]
    100668402 (MYH11)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100668402 (MYH11)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100668402 (MYH11)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N Crescentin CC2-LZ IQ AAA_22
Other DBs
NCBI-GeneID: 100668402
NCBI-ProteinID: XP_003421934
LinkDB
Position
Unknown
AA seq 1972 aa
MAQKGQLSDDEKFLFVDKNFINNPVAQADWAAKKLVWVPSEKQGFEAASIKEEKGDEVIV
ELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGL
FCVVVNPYKHLPIYSEKIVEMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKDKMKNDLL
LEGFSNYTFLSNGFVPIPAAQDDEMFQETLEAMAIMGFSEEEQMSILRVVSSVLQLGNIV
FKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRCILTPRIKVGRDLVQKAQTKEQADFA
VEALAKATYERLFLWILNRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECW
FPKATDKSFVEKLCTEQGNHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLN
DNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSATKTKKGMFRTVGQLYKEQ
LGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILTANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEE
ERDLKITDVIMAFQAMCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTK
VKPLLQVTRQEEEMQAKEDELQKTKERQQKAESELKELEQKHTQLTEEKNLLQEQLQAET
ELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAEKKKMAQQMLDLEEQLE
EEEAARQKLQLEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEE
KAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLDGEASDLHEQIADLQAQIAE
LKMQLAKKEEELQAALARLEDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQ
KRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQK
HTQVVEELTEQLEQFKRAKANLDKNKQTLEKENADLTSELRVLTQAKQEVEHKKKKLEVQ
LQELQSKYSDGERARAELNDKVHKLQNEVESVTSMLNEAEGKAIKLAKDVASLGSQLQDT
QELLQEETRQKLNVSTKLRQLEDERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKL
QDFASTVEVMEEGKKRLQKEIEGLTEQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQR
QLVSNLEKKQKKFDQLLAEEKNISSKYADERDKAEAEAREKETKALSLARALEEALEAKE
ELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATED
AKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAAAAKK
KLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEK
KAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSVSGRNTLQDEKRRLEARIAQ
LEEELEEEQGNMEAMSDRFRKATQQAEQLNNELATERSTAQKNESARQQLERQNKELRSK
LQEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEARDKQAAAKSLKQKDKKLKEVLLQVED
ERKMAEQYKEQAEKGNLRVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGRE
VNALKSKLRRGNETSFVPSRRSGGRRVIENADGSDEEMDTRDADFNGTKASE
NT seq 5919 nt   +upstreamnt  +downstreamnt
atggcacagaaaggccaactcagtgatgatgagaagttcctttttgtggacaaaaatttc
atcaacaatccagtggcccaggctgactgggctgccaagaaactggtctgggtcccttcg
gagaagcagggcttcgaggcagccagcatcaaggaggagaagggggatgaggtgattgtg
gagctggtggagaatggcaagaaggtaacggtcggcaaggatgacatccagaagatgaac
ccacccaagttctccaaggtggaggacatggcggagctgacgtgcctcaacgaagcttct
gtattgcacaacctgagggagagatacttctcgggactcatatacacatactccggcctc
ttctgcgtggtggtcaacccctacaagcacctgcccatctactcggaaaagatcgtcgaa
atgtacaagggcaagaagaggcacgagatgcccccccatatctatgccatcgccgacacg
gcctaccggagcatgctgcaagatcgggaggaccagtccattctatgcacaggtgagtct
ggagctgggaaaacggaaaacaccaagaaagtcatccagtacctggccgtggtagcctcc
tcccacaagggcaagaaagacacaagcatcacgggtgagctggaaaagcagcttctacaa
gcaaacccgattctggaagcttttggcaacgccaaaaccgtcaagaacgacaactcctca
cgatttggcaaattcatccgcatcaactttgacgtcacgggttacatcgtgggagccaac
atcgagacctacctgctagaaaagtcacgggcgattcgccaagccagagacgagcggaca
ttccacatcttttactacatgattgctggtgccaaggacaagatgaaaaatgacttgctt
ttggagggcttcagcaactacacattcctctccaatggctttgtgcccatcccggctgcc
caggatgacgagatgttccaggaaaccttggaggccatggccatcatgggcttcagcgaa
gaggagcagatgtccatattgagagtggtgtcgtctgtcctgcagcttggaaatattgtc
ttcaagaaggaaagaaacacagaccaggcatccatgccggataacacagctgctcagaaa
gtttgccacctcatggggattaatgtgacggacttcaccagatgcatcctgaccccacgt
atcaaagttgggcgggacttggtacagaaagctcagacaaaagaacaggctgactttgct
gtagaggccctggccaaggccacttatgagcgtcttttcctctggatactcaaccgtgtg
aacaaagccctggacaagactcatcggcaaggggcttcgttcctggggatcctggacatt
gcaggctttgagatctttgaggtgaactccttcgagcagctctgcatcaactacaccaac
gagaagctgcagcagctcttcaaccataccatgttcatcctggagcaggaggagtaccag
cgcgagggcatcgagtggaacttcatcgacttcgggctggacctgcagccctgcatcgag
ctcattgagcggccgaacaacccaccaggtgttctggccctgctggatgaggaatgctgg
ttccccaaagccacagataagtccttcgtggagaagctgtgcacagagcagggcaaccac
cccaagttccagaagcccaagcagctcaaggacaagactgagttctccatcattcactat
gccgggaaggtggactacaacgcgagtgcctggctgaccaagaacatggacccactgaat
gataatgtgacttcgctcctcaatgcctcctcagacaagtttgtggccgacctgtggaag
gatgtggaccgcatcgtggggctagaccagatggccaagatgacagagagctcgctgccg
agtgccaccaagaccaagaagggcatgttccgcactgtggggcagctctataaggagcag
ctagggaagctgatgaccacactgcgcaacaccacacccaactttgtgcgctgcatcatc
cccaaccacgagaagaggtcaggcaagctggacgcgtttctggtgctggagcagctgcgg
tgcaacggagtgttggaaggcatccggatctgtcgtcagggcttccccaacaggatcgtc
ttccaggagttccgccaacgctatgagatcctgacggcaaatgccattcccaaaggcttc
atggacgggaagcaggcctgcattctcatgatcaaagccctagagctcgatcccaacttg
tataggattgggcagagcaaaatcttcttccgaactggggtcctggcccacctggaggag
gaacgagacttgaagatcacagacgtcatcatggccttccaggcgatgtgccgaggctac
ctggcaagaaaggcctttgccaagcggcagcagcagctgacagccatgaaggtgatccag
aggaactgtgccgcctacctcaagctgcggaactggcagtggtggaggctcttcaccaaa
gtgaagccgctgctgcaggtgacccgacaggaagaggagatgcaggccaaggaggatgag
ctgcagaagaccaaggagcggcagcagaaggcggagagcgagctcaaggagctggagcag
aagcacacacagctgactgaggagaagaacctgctgcaggagcaactgcaggcagagacg
gagctgtatgcggaggctgaggagatgcgggtccggctggccgccaagaagcaggagctg
gaggagattctgcatgaaatggaggcccgcttggaggaggaggaggacaggggccagcag
ctgcaagccgaaaagaagaaaatggcccaacagatgctggacctggaagaacagctagag
gaggaggaagctgcgaggcagaagctacagcttgagaaggtcacagctgaggccaagatc
aagaagctggaggatgagatcctggtcatggatgaccagaacaataagctgtccaaggag
cgaaaactcctcgaagagaggattagtgacttaacgacaaatcttgcagaagaggaagaa
aaagccaagaatctcacgaagttgaaaaacaagcacgaatctatgatttcagaactggaa
gtgcggctgaagaaagaggagaagagccgacaggagctagagaagctgaagcggaagctg
gacggcgaggccagcgacttgcatgagcagattgctgacctccaggcacagatcgccgag
ctcaagatgcagctggccaagaaagaggaagagctgcaggcggccctggccaggctcgaa
gatgaaattgctcagaagaacaatgccctgaagaagattcgggagctggagggccacatc
tctgaccttcaggaggacctggactccgagagggcggcgaggaacaaggctgagaagcag
aagcgagacctgggggaggagctggaggcactgaagacggagctggaggacacgctggac
agcaccgccacccaacaggagcttagggccaagagggagcaggaggtgactgtgctgaag
aaggccctggatgaggagactcggtcccacgaggcccaggtccaggagatgaggcagaaa
cacacacaggtggtggaggaactcactgaacagctcgagcagttcaagagggccaaggca
aacctagacaagaacaagcagacgctggagaaggagaacgcagacctaaccagcgagcta
agggtcctgacccaggcaaagcaggaggtggagcacaagaagaagaagctggaggtgcag
ctgcaggagctgcagtccaagtacagtgatggggagcgggctcgcgcagaactcaacgac
aaggtccacaagctgcagaacgaagtggagagtgtcacaagcatgctcaatgaggcggag
gggaaggctatcaaactagccaaggacgtggcatcccttggatcccagctccaggataca
caggagctccttcaagaagaaacccggcagaagctcaatgtgtccaccaaactccgccaa
ctggaggatgagaggaacagcctgcaggaccagctggatgaggagatggaggccaagcag
aacctggaacggcacatatcaactctgaacatacagctctctgattcaaaaaagaagctg
caggactttgccagcaccgtggaagtcatggaagagggcaagaagaggctccagaaggaa
attgaaggccttaccgagcagtatgaagagaaggcagctgcctatgacaaactggaaaag
accaagaacaggcttcagcaggagctggatgacctggtcgttgatttggacaaccagcgg
caactggtgtccaacctggaaaagaagcagaagaagtttgatcagttgttagccgaggag
aaaaacatctcttccaaatatgcggatgaaagggacaaagcagaagcagaagccagagaa
aaggaaaccaaggccttgtccctggctcgggcccttgaagaggccttggaagctaaagag
gaactcgagaggaccaacaagatgctcaaagctgagatggaagatctggttagctccaag
gatgatgtgggcaagaatgtccatgagctggagaagtccaagcgtgccctggagacccag
atggaggagatgaagacccagctggaagagttggaggatgagctgcaggcaacagaagat
gccaagctgcggctcgaggtcaacatgcaagccctcaagggccagtttgagagagatctc
caagcccgggacgagcagaatgaagaaaagaggaggcagctccagaggcagcttcacgag
tatgagacagaactggaagatgagcgaaagcaacgcgcactggcggctgcagccaagaag
aagctggaaggggacttgaaagacctggagctgcaggctgactcagccatcaaggggagg
gaggaagcgatcaagcagcttcggaaactgcaggcgcagatgaaggactttcagagagag
ctggaagatgcccgggcatccagagatgagatctttgccacagccaaagagaatgagaag
aaagccaagagcttagaagctgacctcatgcagctacaggaggatcttgccgcggctgag
cgggctcgcaaacaggcagacctggagaaggaagagctggcagaggagctggccagcagc
gtgtcaggaaggaatacactccaagatgagaagcgccgcctggaggcccgcatcgctcag
ctggaggaggagctggaggaggagcagggcaacatggaggccatgagtgaccgtttccgg
aaagccacgcagcaggccgagcagctcaacaacgagctggctacagagcgcagcacagcc
cagaagaacgagagtgcacggcagcagctcgagcggcagaacaaggagctccggagcaag
ctccaggagatggagggggcagtcaagtccaagttcaagtccaccatcgcagcactggag
gccaagatcgcacagctggaggagcaggtcgagcaggaggccagagacaagcaggcagct
gccaagtcactgaagcagaaggacaagaagctgaaggaggtcctgctgcaggtggaggac
gagcgcaagatggcggagcagtacaaggaacaggcggagaagggaaacctgagggtcaag
caactcaagaggcagctggaggaggcggaggaagagtcccagcgtatcaacgccaaccgc
aggaagctacagcgggagctggatgaggccacggagagcaacgaggccatgggccgggag
gtgaacgccctcaagagcaagctcaggcgaggaaacgagacctcttttgttccctctaga
aggtctggaggacgtagagttattgaaaacgcagatggttctgatgaggaaatggacaca
cgagatgcagacttcaatggaaccaaagccagtgaataa

KEGG   Loxodonta africana (African savanna elephant): 100668846
Entry
100668846         CDS       T04351                                 

Gene name
MYH10
Definition
(RefSeq) myosin-10
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
lav04530  Tight junction
lav04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100668846 (MYH10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100668846 (MYH10)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100668846 (MYH10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100668846 (MYH10)
   04147 Exosome [BR:lav04147]
    100668846 (MYH10)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100668846 (MYH10)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100668846 (MYH10)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ ADIP CC2-LZ Crescentin Erf4 AAA_22
Other DBs
NCBI-GeneID: 100668846
NCBI-ProteinID: XP_003416967
LinkDB
Position
Unknown
AA seq 1972 aa
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPGELERQLLQANPILESFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLL
LEGFSNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNIS
FKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA
VEALAKATYERLFRWLVHRINKALDRTKRQGASFIDSGFHIFQLNSFEQLCINYTNEKLQ
QLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKA
TDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVA
TLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKL
MATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEF
RQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDL
KITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPL
LQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFA
EAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEG
ARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKN
LAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDELKIQ
LAKKEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDL
SEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQRHATA
LEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQEL
HAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGVKFAKDAAGLESQLQDTQELL
QEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLTDTKKKVDDDL
GTIESLEEAKKKLLKDVEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQIVS
NLEKKQKKFDQLLAEEKNISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFER
QNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLR
LEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKKKMEI
DLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKS
LEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEE
LEEEQSNMELLNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAKLQEL
EGTVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRH
ADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTL
KNRLRRGGPISFSSSRSGRRQLHIEGASLELSDDDTESKTSDVNETQPPPSE
NT seq 5919 nt   +upstreamnt  +downstreamnt
atggcacaaagaactggactcgaagatcctgagaggtatctctttgtggacagggctgtc
atctacaaccctgccactcaagccgattggacagctaaaaagttagtgtggattccatca
gaacgccatggctttgaggcagctagtatcaaagaagagcgcggagacgaagttatggtt
gagctggctgagaatggaaagaaagcaatggtcaacaaagatgatattcagaagatgaac
ccacccaagttttccaaggtggaggatatggcagagttgacatgcttgaatgaagcatct
gttttacataatctgaaggatcgctactattcaggacttatctacacttattctggactc
ttctgtgtagtcataaatccttacaagaatcttccaatttactctgagaatattattgaa
atgtacagagggaagaaacgtcacgagatgcctccacacatctatgctatatctgaatct
gcttacagatgcatgcttcaagatcgtgaggaccagtcaattctttgcacgggtgaatca
ggggccgggaagacagaaaatacgaagaaagtcattcagtaccttgcccacgttgcttct
tcacataaaggaagaaaggaccacaatattcctggggaacttgaacggcagcttttgcaa
gcaaatccaattctggaatcatttggaaacgcgaagactgtgaaaaatgataactcatct
cgttttggcaagtttattcggatcaactttgatgtaactggttatatcgttggggccaac
attgaaacataccttctagaaaagtctcgtgctgttcgtcaagcaaaagatgagcggact
tttcatatcttttaccagttgttgtctggagcaggggaacacctgaagtctgatttgctc
cttgagggatttagtaactacaggtttctctccaatggctatatccctattccgggacag
caagacaaagataacttccaggagacaatggaagcgatgcatataatgggcttctctcac
gaagaaattctgtcaatgcttaaagtagtatcttcagtgctgcagtttgggaatatttct
ttcaaaaaggagaggaataccgatcaagcttccatgccagaaaatacagttgcccagaaa
ctgtgccatcttcttgggatgaatgtgatggagttcactcgggctatacttacccctcgg
atcaaggtcggccgagactatgtgcagaaggcccagaccaaagaacaagcagattttgca
gtagaagcactggcaaaagctacctatgagcggctctttcgctggcttgttcaccgtatt
aataaagctctagataggaccaaacgtcagggagcgtctttcattgattctggattccac
attttccagctgaactcctttgagcagctttgcatcaactacaccaacgagaaactgcag
cagttgttcaaccacaccatgttcatcctggagcaggaggagtaccagcgggaaggcatc
gagtggaactttattgattttggattagatctgcagccctgcattgacttaatagagaga
cccgctaaccctcctggtgtcctggcccttctggatgaagagtgctggtttcctaaagcc
actgataaaacctttgtggaaaaactggtgcaagagcaaggatcccactccaagttccag
aaacctcggcaactgaaagacaaagccgatttttgcattatacattatgcagggaaggtg
gactacaaggcagacgagtggctgatgaagaacatggaccctctaaatgacaacgtggcc
acccttttgcaccagtcctcagacagattcgtggcagagctttggaaggatgtggaccgg
atcgtgggtctggatcaagttactggcatgaccgagactgctttcggctctgcatataag
accaagaagggcatgttccgtaccgtcggacaactctacaaagagtctctcaccaaactg
atggccactctccgcaacaccaacccgaactttgttcgctgcatcattcccaatcacgag
aagcgggctggaaaactggacccgcatctagtgctggatcagcttcgctgcaatggggtc
ctggaagggatcagaatctgccgccagggcttcccaaatcgcatcgttttccaggaattc
agacagagatacgagatcctaaccccaaatgctattcctaaaggctttatggatggtaaa
caggcttgtgaacgaatgatccgagctttagaactggaccctaacttgtacagaattgga
cagagcaagatatttttcagagctggagttttggcacacttagaggaagaaagagatttg
aaaattactgatatcatcatcttcttccaggctgtttgcagaggttacctagccagaaag
gccttcgccaagaaacagcagcaactgagtgccttgaaggtcttgcagcggaactgtgcc
gcgtacctgaaactgcggcactggcagtggtggcgagtcttcacaaaggtgaagcccctc
ctacaagtgactcgccaagaggaagagcttcaggccaaagatgaggagctgttgaaggtg
aaggagaagcagaccaaggtggaaggcgagctggaggagatggagaggaagcatcagcag
cttttagaagagaagaatatcctcgccgagcaactgcaggcagagacggagctctttgct
gaggcagaagagatgcgagcaagactggctgctaaaaagcaggaactagaagagattctg
catgacttggagtctcgggttgaagaagaagaagaaagaaaccaaatccttcaaaatgaa
aagaaaaaaatgcaagcacatattcaggacctggaggagcagctggatgaggaagaaggt
gcgcggcagaaactgcagctggaaaaggtcacagcagaagcgaagatcaagaagatggag
gaggagattctgcttctagaggaccaaaattccaaatttatcaaagaaaagaagctcatg
gaagatcgcattgctgagtgctcctctcagctggctgaagaggaagaaaaggcaaagaac
ttggccaaaatcaggaacaagcaggaagtgatgatctcagatttagaagaacgcttaaag
aaggaagagaagactcgtcaggagctggaaaaggccaaaagaaaactagacggtgaaact
actgacctgcaagaccaaatcgcagagctccaggcccagattgatgagctcaagatccag
ctggccaagaaggaggaggagctgcagggtgccctggccagaggtgatgatgaaacactt
cataagaataatgcgctgaaagtcgtgcgggagctacaagcccaaatcgctgagcttcag
gaagactttgaatctgagaaggcgtcacggaacaaggcagaaaagcaaaaaagggacttg
agtgaggaactggaggccctgaaaacggagctggaggacaccctggacacgactgcagcc
cagcaggaacttcgaacaaaacgtgagcaggaagtggcagagctgaagaaggctcttgag
gaagaaaccaagaaccatgaggcgcaaatccaggacatgagacaaagacatgccacggcc
ttggaggagctctcagagcagctggagcaggcaaaaaggttcaaagcaaatctggagaag
aacaagcagggcctggagacagacaacaaggagctggcgtgtgaggtgaaggtcctgcag
caggtcaaggccgaatctgagcacaagaggaagaaacttgatgcccaggtccaggagctc
cacgccaaggtctcggaaggagacagactgagggtggagctggccgagaaagccaacaag
ttacagaatgagttagataatgtctccacacttctggaagaagcagagaagaagggtgtt
aagtttgctaaggacgcagctggtctggagtctcaactacaggatacacaggagcttctt
caggaggagacccgccagaaactgaatctgagcagtcgaattcggcagctcgaagaggag
aagaacagtcttcaggagcagcaggaggaagaggaggaggccaggaaaaacctggagaag
caggtgttggccttgcagtcccagttgacggatactaagaagaaggtagatgatgacttg
ggaacaattgaaagtttggaagaagccaagaagaagcttcttaaagacgtggaggcactc
agccagcgcctggaagagaaggctttggcttatgataagctcgagaagaccaagaaccgc
ctgcagcaggagctggacgacctgacagtcgacctggaccaccagcgccagatcgtctcc
aacttagagaagaagcagaagaagttcgaccagctgttagcagaggagaagaacatctct
gctcgctatgcagaagagcgggaccgtgcggaagcagaggccagagagaaggagactaaa
gccctgtccctggcccgggcccttgaggaagccctggaggccaaggaagagtttgagcgg
cagaacaagcagctgcgcgcagacatggaggacctgatgagctccaaagacgacgtgggc
aagaatgttcacgaactcgagaaatccaaacgggccctggagcagcaggtggaggaaatg
aggacccagctggaggagctggaagatgaacttcaggcaacagaagacgccaagctccgc
ctggaggtcaacatgcaggccatgaaggcccagttcgagagggacctgcagaccagagat
gagcagaatgaagaaaagaagcggctgctgattaaacaggtccgggagctggaagcagag
ctggaggatgagcgtaaacagcgggctctggctgttgcttcaaagaagaaaatggaaata
gacctgaaggacctggaagcccaaatcgaagctgcgaacaaagctcgggatgaagtgatc
aagcagcttcgcaaactgcaggctcagatgaaagattaccagcgtgaattagaagaagct
cgtgcctcccgggacgagatttttgctcaatccaaagagagtgaaaagaaactgaaaagt
ctggaagcagaaatacttcagttgcaggaggagcttgcctcgtccgagcgtgcccgccga
cacgctgagcaggagagagacgaactggccgatgagattgccaacagtgcttctggcaag
tctgcactgctggacgagaagcggcgtctggaggcgcggatcgcacagctggaggaggaa
ctggaagaggagcagagcaacatggagctgctcaatgaccgcttccgcaagaccacactg
caggtggacacgctgaacacagagctggcggctgagcgcagtgccgcccagaagagcgac
aatgcacgccagcagctagagcggcagaacaaggaactgaaggccaagctgcaggagttg
gagggtaccgtcaagtccaagttcaaagccaccatctcagccttggaagccaagattggg
cagctggaggagcagctggagcaggaagccaaggaacgagcagccgccaacaagctggtc
cgtcggacggagaagaagctgaaagagatcttcatgcaggtggaggacgagcgccgccac
gcggatcaatacaaggagcagatggagaaggccaacgccaggatgaagcagctcaaacgc
cagctggaggaagcagaagaagaagctacacgtgccaacgcatctcggcgtaaactccag
cgggaactggacgacgccaccgaggccaacgaaggcctgagccgcgaggtcagcaccctc
aagaaccggctgaggcggggaggcccaatcagcttttcttccagccgatccggccggcgc
cagctgcacattgagggggcttctctggagctgtcagacgatgacacagaaagtaagacc
agtgatgtcaatgaaacgcagccacccccgtccgagtag

KEGG   Loxodonta africana (African savanna elephant): 100671983
Entry
100671983         CDS       T04351                                 

Gene name
MYH9
Definition
(RefSeq) LOW QUALITY PROTEIN: myosin-9
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04270  Vascular smooth muscle contraction
lav04530  Tight junction
lav04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100671983 (MYH9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100671983 (MYH9)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100671983 (MYH9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100671983 (MYH9)
   04147 Exosome [BR:lav04147]
    100671983 (MYH9)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100671983 (MYH9)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100671983 (MYH9)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ CC2-LZ Crescentin AAA_22
Other DBs
NCBI-GeneID: 100671983
NCBI-ProteinID: XP_023415720
LinkDB
Position
Unknown
AA seq 1867 aa
MAQQAADKYLYVDKNLINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLLRVISGVLQLGNIAFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQVEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEDQIIMEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLNDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLMQGKGDSEHKRKKVEAQLQELQVK
FNEGERVRMELADKVSKLQVELDNVTGLLNQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLSLSTKLKQMEDEKNSFKEQLEEEEEAKQNLEKQIATLHAQVTDMKKKMEDGVGCL
ETAEEAKRKLQKDLEGLSQRFEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEETSEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDXKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLIRQVREMEAELEDERKQRSMAMAARKKLEMDLK
DLEAHIDSANKNRDEAIKQLRKLQAQMKDYMRELEDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELDE
EQSNTELVNDRLKKTNLQIDQLNTDLNLERSQAQKNENARQQMERQNKELKVKLQEMEGT
VKSKYKAAIAALEAKITQLEEQLDNETKYMPLPQPTQAIDAQGLDPPSGPAGMLSPELGQ
EPGQKPA
NT seq 5604 nt   +upstreamnt  +downstreamnt
atggcgcagcaagctgctgataagtatctctatgtggataaaaacttaatcaataaccca
ctggcccaggccgactgggctgccaagaagctggtgtgggtgccttccgacaagagtggc
tttgagcccgccagcctcaaggaggaggtaggcgaggaggccattgtggagctggtggag
aatgggaagaaggtgaaggtgaacaaggatgacatccagaagatgaacccacccaagttc
tccaaagtggaggacatggcggagctcacgtgcctcaacgaggcctcggtgctgcacaac
ctcaaggaacgctactactcagggctcatctacacctactcaggcctgttctgtgtggtc
atcaatccttacaagaacctgcccatctactccgaagagatcgtggaaatgtacaagggc
aagaagaggcatgagatgcccccccacatctacgccatcacagacactgcctacaggagt
atgatgcaagaccgagaggatcagtccattttgtgcacgggtgagtctggagctggcaag
acagagaacaccaagaaggtcattcagtacctggcttatgtggcctcctcacacaagagc
aagaaggaccagggtgagctggagcggcagctgctgcaggccaaccccatcctggaggcc
tttgggaatgccaagaccgtgaagaacgacaactcctcacgctttggcaaattcattcgt
atcaactttgatgtcaatggctacatcgtgggagccaacattgagacctatcttttggag
aaatcccgtgccatccgccaggccaaggaggagcgcaccttccacatcttctactatctc
ctctctggggctggagagcacctgaagactgacctcctgttggagccgtataacaaatac
cgcttcctgtccaatgggcatgtcaccatccccgggcagcaggacaaggacatgttccag
gagaccatggaggccatgaggatcatgggcatcccggaagacgagcaaatgggcttgctg
cgtgtgatctcaggggttcttcagcttggcaacatcgccttcaagaaggagcgcaacacc
gaccaggcatccatgcccgacaacacagctgcccaaaaagtgtcccaccttttgggcatc
aatgtgactgatttcacccgaggaattctcaccccgcgcatcaaggtgggaagggattat
gtccagaaggcacaaacaaaagaacaggctgactttgccatcgaggccttggccaaggcc
acctacgagcggatgttccgttggctggtgctgcgcatcaacaaggctctggacaagacc
aagaggcagggcgcctcgttcatcggaatcctggacatcgccggcttcgagatcttcgat
ctgaactccttcgagcagctctgcatcaactacaccaacgagaagctgcagcagctcttc
aaccacaccatgttcatcctggagcaggaggagtaccagcgcgagggcatcgagtggaac
ttcatcgacttcgggctggacctgcagccctgcatcgacctcattgagaagccagcaggc
cccccaggcatcctggccctgctggatgaggagtgctggttccccaaagccaccgacaag
agcttcgtggagaaggtggtgcaggagcagggcacccaccccaagttccagaagcccaag
cagctgaaggacaaagccgatttctgcatcattcactatgctggcaaggtggactacaag
gctgacgagtggctgatgaagaacatggaccccctgaatgacaacgttgccacgctgctc
caccagtcctccgacaagttcgtctcggagctgtggaaggatgtggaccgcatcatcggc
ctggaccaggtggccggcatgtcggagacggcgctgcccggggccttcaagacacggaag
ggcatgttccgcacagtggggcagctgtacaaggagcagctggccaagctgatggccacg
ttgaggaacaccaaccccaacttcgtccgctgcatcatccccaaccatgagaagaaggct
ggcaagctagacccccatctcgtgctggaccagctgcgctgcaatggggtcctggagggc
atccggatctgccgccagggcttccccaacagagtagttttccaggaattccggcagaga
tacgagatcctgactccgaattccatccctaagggcttcatggacgggaagcaggcatgc
gtgcttatgatcaaggccttggagctggacagcaacctgtaccgcatcggccagagcaaa
gtcttcttccgggctggcgtgttggcccacctggaggaggagcgggacctgaagatcacg
gatgtcatcattggcttccaggcctgctgtaggggatacctggccagaaaggcctttgcc
aagcggcagcagcagctgacggccatgaaggtcctacagagaaactgtgctgcttacctc
aagctgcggaactggcagtggtggcggctcttcaccaaggtcaagccgctgctgcaggtg
agccggcaggaggaggagatgatggccaaggaggaggagctggtaaaggtccgagagaag
cagctggcagccgagaacagactcactgagatggagacactccagtcccagctcatggca
gagaagctgcagctgcaggagcagctccaggcagagacagagctgtgtgccgaggctgag
gagctccgggcccgcctgacggccaagaagcaggagctagaagagatttgccatgacctc
gaggccagggtggaggaggaggaggagcgctgccagcacctgcaggtggagaagaagaag
atgcagcagaacatccaggaactggaggagcagctggaggaggaggagagtgcccgccag
aagctgcagctggagaaggtgaccaccgaggccaagctgaagaagctggaagaagaccag
atcatcatggaagaccagaactgcaaactggccaaggagaaaaagttgctggaagacaga
atagctgagttcaccaccaaccttacagaggaggaggaaaaatcaaagagcctcgccaag
ctgaagaacaaacacgaggcgatgattactgacttggaagagcgccttcgaagagaagag
aagcagcgtcaagagctggagaagacccgccggaagctggagggagactccacggacctc
aatgaccagattgctgagctccaggctcagattgccgagctcaagatgcagctggctaag
aaagaggaggagctccaggctgccctggccagagtggaggaagaagctgcccagaagaac
atggccctgaagaagattagggagctggaatctcagatttctgaactccaggaagaccta
gagtctgagcgtgcttctaggaacaaagccgagaagcagaagcgggaccttggggaagag
ttggaggctctgaaaacagagttagaggacaccttggattccaccgctgcccagcaggag
ctcaggtctaaacgtgaacaggaagtgaacatcctgaagaagaccctcgaggaggaggcc
aagacccacgaggcccagatccaggagatgaggcagaagcactcacaggccgtggaggag
ctggcagagcagttggaacagacgaaacgggtgaaagccaaccttgagaaggcgaagcag
accctggagaatgagcgaggggagctggccaacgaggtgaaggtcctgatgcagggcaaa
ggggactccgagcacaagcggaagaaagtggaggcccagctgcaggagctccaggtgaag
ttcaacgagggcgagagagtgcgcatggagctggccgacaaggtctccaagctgcaggtt
gagctggacaatgtcacaggccttctcaaccagtccgacagcaagtctagcaagctgacg
aaggacttctctgctctggagtcccagctacaggacactcaggagctgctgcaggaggag
aaccggcagaagctgagcctcagcaccaagctgaagcagatggaggacgagaagaactcc
ttcaaggaacagctggaggaggaggaggaggccaagcagaacctcgagaagcagatcgcc
accctgcacgcccaggtgaccgacatgaagaagaagatggaggatggtgtggggtgcctg
gagactgcagaggaagccaagaggaagctccagaaggacctggagggcctgagccagcgt
ttcgaggagaaggtggccgcctatgacaagctggagaagaccaagacacggctgcagcag
gagctggacgacctgctggtggacctagaccaccagcggcagagtgtctccaacctggag
aagaagcagaagaagtttgaccagctcctggcagaggagaagaccatctctgccaagtat
gcagaggagcgtgaccgggccgaggcagaggcccgagagaaggagaccaaggcgctgtcg
ctggcccgggccctggaggagacctcagagcagaaggcggagctggagcggctcaacaag
cagttccgcacagagatggaggacctcatgagctccaaggacgatgtcggcaagagcgtc
catgaactggagaagtccaagcgggccctggagcagcaggtggaggaaatgaagacccag
ctggaggagctggaggacgagctgcaggccacagaggatnacaagctgcggctagaggtg
aacctgcaggccatgaaggcccagttcgagcgggaccttcagggccgcgacgagcagagc
gaggagaagaagaagcagctgattcgacaggtgcgcgagatggaggcagagctggaggat
gagaggaagcagcggtcaatggccatggctgcgcggaagaagctggagatggacttgaag
gacctggaggcccacattgactcagccaacaagaaccgagatgaagccatcaagcagctt
cggaagctgcaggcccagatgaaggactacatgcgtgagctggaggacacgcgtgcctcc
cgggaggagatcctggcgcaggccaaggagaacgagaagaagctgaagagcatggaggcc
gagatgattcagctgcaggaggaactggcagctgctgagcgtgccaagcgccaggcccag
caggagcgggacgagctggctgacgagatcgccaacagcagtggcaaaggagccctggcg
ttggaggagaagcggcgcctggaggcccgcattgcccagctggaggaggagctagacgag
gagcagagtaacacggagctggtgaacgaccggctgaagaagacgaacctgcagatcgat
cagcttaacaccgacctgaacctggagcgcagccaagcccagaagaatgaaaacgcacgg
cagcagatggagcgccagaacaaggagctcaaggtcaagctgcaggagatggagggcacc
gtcaagtccaagtacaaggccgccatcgccgccctagaggccaagatcacacagctggag
gagcagctggacaacgagaccaagtatatgcccctaccccagcccacccaagctatagat
gcccagggcctggacccaccctcgggccctgctgggatgctgtccccagagctaggtcag
gagccaggacagaaaccagcctga

DBGET integrated database retrieval system