KEGG   Loxodonta africana (African savanna elephant): 100655829
Entry
100655829         CDS       T04351                                 

Gene name
BECN2
Definition
(RefSeq) LOW QUALITY PROTEIN: beclin-2
  KO
K08334  beclin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04136  Autophagy - other
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04215  Apoptosis - multiple species
lav04371  Apelin signaling pathway
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100655829 (BECN2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100655829 (BECN2)
   04136 Autophagy - other
    100655829 (BECN2)
   04137 Mitophagy - animal
    100655829 (BECN2)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100655829 (BECN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100655829 (BECN2)
   05014 Amyotrophic lateral sclerosis
    100655829 (BECN2)
   05016 Huntington disease
    100655829 (BECN2)
   05017 Spinocerebellar ataxia
    100655829 (BECN2)
   05022 Pathways of neurodegeneration - multiple diseases
    100655829 (BECN2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100655829 (BECN2)
Membrane trafficking [BR:lav04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    100655829 (BECN2)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100655829 (BECN2)
SSDB
Motif
Pfam: APG6 APG6_N DUF812 FPP DUF3450 FlaC_arch DegS
Other DBs
NCBI-GeneID: 100655829
NCBI-ProteinID: XP_010589421
LinkDB
Position
Unknown
AA seq 465 aa
MMSVKASNMSSICFICHCCSKPLKLKQSMGTLMSLSTTQQQPAPPLPLALGKSGGTQEED
STFRKETDTASLQDGASYGPLVDDSMTSWEGSMTRENCNTFTLLGKMCSMRTLNSIQETI
VDIFDILSGEKEVDHPLCEECTDNLLEQLDVQLTITEYESQMYRRCLETRELTTCENEME
ALQMELESLELEEARLAQELDDVEKNWKQAAGDLEAAQVEAEILNQQEKQSQRDYSVLKQ
QQLELFDELRSLENRLRYAQIQLGWLTKTNVFHMTFDIRHHGPLGIINNFKLGCLSTVPV
TWSEINAAWGQTALLLLVLSKKMGLDFQRYQLVPCGNHSYLKSLTDDSVELPLFHCMGQN
VFLDKFDLAMVAFLDCLQQLKEKAKKGGLHLPYRINVERGQMEDPVGRGEYYSIRTLLNT
EEQWTKALKFMLVNLKWSLTWVSKRXRQKRLSLFLLRERGIFPLK
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgatgagcgtcaaggcctctaacatgtcctccatctgcttcatttgccactgctgcagc
aagcccctgaaactgaagcagtccatggggaccctgatgagccttagcaccacccaacaa
cagccagctccaccactccccctggctctggggaagtcaggagggacccaggaggaagat
tctactttcagaaaggagacagatactgcaagtctgcaggatggtgcctcttatggaccc
ctcgttgatgacagcatgacgtcctgggagggttccatgaccagggagaattgcaacacc
ttcaccctgcttgggaagatgtgttccatgagaacactcaacagcatccaggagaccatt
gtggacatatttgacatcctttctggtgagaaagaagtcgatcaccccctgtgtgaggag
tgcactgacaaccttctagagcagctagatgtccaactcaccatcacagaatatgagagt
cagatgtacagacgctgcttggagaccagggagctgacaacgtgtgagaacgagatggag
gcgttgcagatggagctggagagcctggagctggaggaggcaaggctggcccaggagctg
gatgatgtggagaagaactggaaacaggcagcaggagatctcgaggcagcccaggtagag
gctgagatactgaatcagcaggagaagcagtcccagagggactacagcgtcttgaaacag
caacaactggaactgtttgacgagctaaggagcttggagaaccggctgcggtatgcccag
attcagctgggctggctgacgaaaaccaacgtcttccacatgacatttgatatccggcat
catggccccttgggcatcatcaataacttcaagttgggctgcctctccactgtccccgtg
acctggagtgagatcaacgctgcctggggacagacagctctgcttctacttgtcctgtcc
aagaaaatgggactggactttcagaggtatcaacttgtcccctgtggaaaccattcctat
ctgaagtctctaacagatgactctgttgagctgccattgttccattgcatgggacagaat
gtcttcttggataagtttgaccttgcgatggtggctttcttggactgtttgcagcagtta
aaggaaaaggccaagaaagggggtctccacctgccttacaggatcaatgtggagaggggc
cagatggaagaccctgttggcagaggtgaatactattccatcaggaccctcttgaacacc
gaggagcagtggacaaaggcgctcaaatttatgcttgtaaatttgaagtggagtctcact
tgggtctccaaaaggtaacgtcaaaaaagactttctttgtttcttttgagggagaggggg
atttttcctttaaaatag

KEGG   Loxodonta africana (African savanna elephant): 100675111
Entry
100675111         CDS       T04351                                 

Gene name
BECN1
Definition
(RefSeq) beclin-1 isoform X1
  KO
K08334  beclin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04136  Autophagy - other
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04215  Apoptosis - multiple species
lav04371  Apelin signaling pathway
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100675111 (BECN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100675111 (BECN1)
   04136 Autophagy - other
    100675111 (BECN1)
   04137 Mitophagy - animal
    100675111 (BECN1)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100675111 (BECN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100675111 (BECN1)
   05014 Amyotrophic lateral sclerosis
    100675111 (BECN1)
   05016 Huntington disease
    100675111 (BECN1)
   05017 Spinocerebellar ataxia
    100675111 (BECN1)
   05022 Pathways of neurodegeneration - multiple diseases
    100675111 (BECN1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100675111 (BECN1)
Membrane trafficking [BR:lav04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    100675111 (BECN1)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100675111 (BECN1)
SSDB
Motif
Pfam: APG6 APG6_N BH3 MT HAUS-augmin3 Exonuc_VII_L ERM FPP NAPRTase_C V_ATPase_I GAS
Other DBs
NCBI-GeneID: 100675111
NCBI-ProteinID: XP_003414307
LinkDB
Position
Unknown
AA seq 453 aa
MAVLGMEGSKTSSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLATAQVKPGE
TQGEEANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLK
VTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDS
EQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFK
RQQLELDDELKSVENQMRYAQMQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVP
VEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGL
RFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKT
QFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcggttctgggaatggaggggtctaagacatccagcagcaccatgcaggtaagcttc
gtgtgccagcgctgcagccagcccctgaaactggacacgagcttcaagatcctggaccgt
gtcaccatccaggagctcacagctccattacttgccacagcccaggtgaaaccaggagag
acccagggggaagaggccaactcaggagaggagccatttatagaaactcgccaggatggt
gtctctcgcagattcatccccccagccaggatgatgtctacagaaagtgccaacagcttc
actctgatcggggaggcatctgatggcggcaccatggagaacctcagccgaagactgaag
gtcactggggacctttttgacatcatgtcaggccagaccgatgtggatcacccactgtgt
gaggaatgcacagatactcttttagaccagctggacacccagctcaacgtcactgaaaat
gagtgtcagaactacaaacgctgtttggaaatcttagaacaaatgaatgaggatgacagt
gaacagctacagatggagctgaaagagctggcactggaggaggagaggctgatccaggag
ctggaagatgtggaaaagaaccgcaagatagtggcagaaaatctcgagaaggtccaggca
gaggctgagagactggatcaggaggaagctcaatatcagagggaatacagtgaatttaaa
cgccagcagctggagttggatgatgagctgaagagtgtagaaaaccagatgcgttatgcc
cagatgcagctggacaaactgaagaaaaccaacgtctttaatgcaacctttcatatctgg
cacagtggacaatttggcacaatcaataacttcagactgggtcgcctgcccagtgttcct
gtggaatggaatgagattaatgctgcttggggccagacggtgttgctgctccatgccctg
gccaataagatgggtctgaaatttcagaggtatcgacttgttccctatggaaaccactca
tacctggagtctctgacagacaaatctaaggagctgccgttatactgttcgggggggttg
cggtttttctgggacaacaagtttgaccatgcaatggtggctttcctggactgtgtgcag
cagttcaaagaagaggttgagaaaggcgagacacgtttttgtcttccttataggatggat
gtggagaaaggcaagattgaagacacaggaggcagcggcggctcctattccatcaaaacc
cagtttaactctgaggaacagtggacaaaagctctcaaattcatgttgacgaatcttaaa
tggggtcttgcttgggtgtcctcacagttttataacaaatga

DBGET integrated database retrieval system