KEGG   Loxodonta africana (African savanna elephant): 100655934
Entry
100655934         CDS       T04351                                 

Gene name
MEF2A
Definition
(RefSeq) myocyte-specific enhancer factor 2A isoform X1
  KO
K09260  MADS-box transcription enhancer factor 2A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04371  Apelin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100655934 (MEF2A)
   04022 cGMP-PKG signaling pathway
    100655934 (MEF2A)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100655934 (MEF2A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100655934 (MEF2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100655934 (MEF2A)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    100655934 (MEF2A)
SSDB
Motif
Pfam: SRF-TF HJURP_C
Other DBs
NCBI-GeneID: 100655934
NCBI-ProteinID: XP_023408831
LinkDB
Position
Unknown
AA seq 490 aa
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINE
EFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGGSLVSPSLTSSSALADSSML
SPPQATLHRNVSPGAPQRPPSTGNAGGMLSTSDLTVPNGAGSSPVGNGFVNSRASPNLIG
TTGANSLGKVMPTKSPPPPGGSSLGMNSRKPDLRVVIPPSSKGMMPPLNTQRISSSQATQ
PLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGMLSLGQVSAWQ
QHHLGQAALSSLVAGGQLSQGSNLSINTNQNINIKSEPISPPRDRMTPSGFQQQQQQQQP
QPLQPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPVVLGRPPNTEDRESPSV
KRMRMDAWVT
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggggcggaagaaaatacaaatcacacgcataatggatgaaaggaaccgacaggtcaca
tttacaaagagaaagtttggattaatgaagaaagcctatgaacttagtgtgctctgtgac
tgtgaaatagcactcatcattttcaacagctctaacaaactgtttcagtatgccagcact
gatatggacaaagttcttctcaagtacacagaatataacgaacctcatgaaagcagaacc
aactcggatattgttgaggctctgaacaagaaggaacacagagggtgcgacagcccagac
cctgatacttcatatgtgctaactccacatacggaagaaaaatataaaaaaattaatgag
gagtttgataatatgatgaggaatcataaaatcgcacctggtttgccacctcaaaacttc
tcaatgtctgtcacagtccctgtgactagccctaatgctttgtcctacacgaacccaggg
ggttcacttgtgtccccatctttgacatccagctcagcgttagcagattcaagcatgctc
tctccacctcaagccacattacatagaaatgtatcccctggagcccctcagagaccacca
agtactggcaatgcaggtgggatgttgagtacttctgacctcacggtgccaaatggagct
ggaagcagcccagtgggtaatggcttcgtaaactcaagagcttctccaaatttgattgga
actactggtgcaaatagtttaggcaaagtcatgcctacaaagtctccccctcctccaggt
ggtagcagtcttggaatgaacagtcgaaaaccagatcttcgagttgtcatccccccttca
agcaagggcatgatgcctccattgaatacccagaggataagcagttctcaagccactcag
cctcttgctactccagtggtgtctgtgacgaccccaagcttgcctccacagggactcgtg
tactcagcgatgcccactgcctacaacactgattactcactgactagtgcggacctatcg
gccctgcagggtttcaactccccaggaatgctgtctttggggcaggtgtcggcctggcag
cagcaccatttaggacaagcagccctcagctctcttgttgctggagggcagttatctcag
ggttcaaatttatccattaataccaaccaaaacatcaacattaagtcagaaccaatttca
cctccccgggatcgaatgaccccatcaggcttccagcaacagcagcagcaacagcagccc
caacccctgcagccccagccccagccccggcaggaaatggggcgctcccctgtggacagt
ctgagcagctctagtagctcctacgatggcagtgaccgagaggatccccggggcgacttc
cattctccagttgtgctgggccgaccgccaaacactgaggacagagaaagcccatctgtg
aagcggatgcggatggacgcgtgggttacttaa

KEGG   Loxodonta africana (African savanna elephant): 100656767
Entry
100656767         CDS       T04351                                 

Gene name
MEF2C
Definition
(RefSeq) myocyte-specific enhancer factor 2C isoform X1
  KO
K04454  MADS-box transcription enhancer factor 2C
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04371  Apelin signaling pathway
lav04921  Oxytocin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05202  Transcriptional misregulation in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100656767 (MEF2C)
   04371 Apelin signaling pathway
    100656767 (MEF2C)
   04022 cGMP-PKG signaling pathway
    100656767 (MEF2C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100656767 (MEF2C)
   04928 Parathyroid hormone synthesis, secretion and action
    100656767 (MEF2C)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100656767 (MEF2C)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100656767 (MEF2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100656767 (MEF2C)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    100656767 (MEF2C)
SSDB
Motif
Pfam: SRF-TF HJURP_C
Other DBs
NCBI-GeneID: 100656767
NCBI-ProteinID: XP_023401380
LinkDB
Position
Unknown
AA seq 465 aa
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI
NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN
SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKS
PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINNSQSAQSLATPVVSVATPTLPGQGM
GGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGA
CTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSPVDSLSSCS
SSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggggagaaaaaagattcagattacaaggattatggatgaacgtaacagacaggtgaca
tttacaaagaggaaatttgggttgatgaagaaggcttatgagctgagcgtgctgtgtgac
tgtgagattgcactgatcatcttcaacagcaccaacaagctgttccagtacgccagcacc
gacatggacaaggtgctgctcaagtacacggagtacaacgagccgcacgagagccggaca
aattcagacatcgtggagacgttgagaaagaagggccttaatggctgtgacagtccagac
cctgatgcagacgattcagtaggtcacagccctgagtctgaggacaagtacaggaaaatt
aacgaagatattgatctaatgatcagcaggcaaagattgtgtgctgttccacctcccaac
tttgagatgccagtctccatcccagtgtccagccacaacagtttggtatacagcaacccc
gtcagctcactgggaaaccccaaccttttgccactggcccacccttctctgcagaggaat
agtatgtctcctggtgtaacacatcgacctccgagtgcgggtaacacaggtggtctgatg
ggtggagacctcacatccggtgcgggcaccagtgcagggaatgggtatggcaatccccga
aactcgccaggtctgctggtctcacctggcaacttgaacaagaatatgcaagcaaaatct
cccccacccatgaatttagggatgaacaaccgtaaaccagatctccgagttcttattcca
ccaggcagcaagaatacgatgccatcagtgaatcaaaggataaataactcccagtctgct
cagtcattggctaccccagtggtttccgtagcaactcctactttaccaggacaaggaatg
ggaggatatccatcagccatttcaacaacatatggtaccgagtattctctgagtagcgca
gacctgtcatctctctctgggtttaacactgccagcgcacttcaccttggctcagtaact
ggctggcaacagcaacacctacataacatgccaccatccgccctcagtcaactgggagct
tgcactagcactcatttatctcagagttcaaatctctccctgccttctactcaaagcctc
aacatcaagtcagaacctgtttctcctcctagagaccgtaccaccaccccttcgagatac
ccacaacacacgcgccacgaggcggggagatctcctgttgacagcttgagcagctgtagc
agttcgtatgatgggagcgaccgagaggatcaccggaacgaattccactcccccattgga
ctcaccagaccttcgccggacgaaagggaaagtccctcagtcaagcgcatgcgactctct
gaaggatgggcaacatga

KEGG   Loxodonta africana (African savanna elephant): 100665046
Entry
100665046         CDS       T04351                                 

Gene name
MEF2B
Definition
(RefSeq) LOW QUALITY PROTEIN: myocyte-specific enhancer factor 2B
  KO
K09261  MADS-box transcription enhancer factor 2B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100665046 (MEF2B)
   04022 cGMP-PKG signaling pathway
    100665046 (MEF2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100665046 (MEF2B)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    100665046 (MEF2B)
SSDB
Motif
Pfam: SRF-TF
Other DBs
NCBI-GeneID: 100665046
NCBI-ProteinID: XP_023407969
LinkDB
Position
Unknown
AA seq 294 aa
MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYAST
DMDRVLLKYTEYSEPHESRTNTDILETLKRRGVGLDGPELEPDEGSEEPGEKLRRLAGDG
GNPALPRPRLYPAAPTMPSPDMVYGALPPPACEPNGLGEALPAQSRPSPFRPTAPKAGPP
GLVHPLFSPSHLASKTPPPLYLAAEGRRPDLPGGLAGGCGGLSTSRGLYGSLQSPCSAQT
RDPHLGASLFLPGGPPEYGLGDPPPPPGLLQPPALGPWEPSRGDGPPGAPAQPR
NT seq 885 nt   +upstreamnt  +downstreamnt
atggggaggaaaaaaatccagatctcacgcattcttgaccaaaggaaccggcaggtgaca
ttcaccaagcggaagtttgggctgatgaagaaggcctacgagctgagcgtactctgtgac
tgtgagattgccctcatcatcttcaacagcgccaaccgcctctttcagtatgccagcaca
gacatggatcgcgtgctgctgaagtacacggagtacagtgagccccatgagagccgcacc
aacactgacatcctcgagacactgaagcggaggggcgtgggccttgatgggccagaactg
gagccagacgaggggtctgaggagccaggagaaaagttgcggaggctggcgggtgatggg
ggcaacccagctctgccccgaccccgcctttatccagcagcccccactatgcccagccca
gacatggtatatggggccctccccccaccggcctgtgaacccaatgggctcggggaggcc
ctgcctgcccaaagtcgcccatcccccttccggccaacagcccccaaagctgggccccca
ggcctggtgcatcctctcttctccccgagccacctcgccagcaagacaccacccccattg
tacctggcagcggagggccggaggccagacctgcctgggggcttggctgggggctgcgga
gggctgagcacctcgagaggcctctacggcagcttgcaaagcccatgctcagcacaaact
cgggacccccatttgggggcttcccttttccttcccggtggccccccagaatatggtcta
ggagaccctccaccgccccctggcttgctgcagccccctgccctgggcccctgggaacct
tcaaggggagatggacccccgggagcccccgcccagcccaggtaa

KEGG   Loxodonta africana (African savanna elephant): 100671016
Entry
100671016         CDS       T04351                                 

Gene name
MEF2D
Definition
(RefSeq) myocyte-specific enhancer factor 2D
  KO
K09262  MADS-box transcription enhancer factor 2D
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04371  Apelin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100671016 (MEF2D)
   04022 cGMP-PKG signaling pathway
    100671016 (MEF2D)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100671016 (MEF2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100671016 (MEF2D)
   04131 Membrane trafficking [BR:lav04131]
    100671016 (MEF2D)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    100671016 (MEF2D)
Membrane trafficking [BR:lav04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100671016 (MEF2D)
SSDB
Motif
Pfam: SRF-TF HJURP_C TFIIA
Other DBs
NCBI-GeneID: 100671016
NCBI-ProteinID: XP_010593138
LinkDB
Position
Unknown
AA seq 511 aa
MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRA
SEELDGLFRRYGSAVPAPNFAMPVTVPVSNQSSLQFSNPSSSLVTPSLVTSSLTDPRLLS
PQQPALQRNSVSPGLPQRPASAGAMLGGDLSSANGACPSPVGNGYVSARASPGLLPVANG
NSLNKVIPAKSPPPPTHSAQLGAPSRKPDLRVITSQGGKGLMHHLNNAQRLGVSQSTHSL
TTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGNVTAWQQP
QQPQQPPQPQPPQPQPQPQQPQQPQPPQQPPQQQPHLVPVSLGNLIPGSPLPHVGAALTV
TTHPHISIKSEPVSPSRERSPAPPPPAVFPAARAEPGDGLSSPAGGSYETGDRDDGRGDF
GPTLGLLRPAPEQEAEGSAVKRMRLDTWTLK
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggggaggaaaaagattcagatccagcgaatcaccgatgagcggaaccgacaggtgaca
ttcaccaaacggaagttcgggctgatgaagaaggcgtacgagctgagcgttctgtgtgac
tgtgagatcgcactcatcatcttcaaccactccaacaagctgttccagtatgccagcacc
gacatggacaaggtgctgctcaagtacacggagtacaatgagcctcacgagagccgcacc
aacgctgacatcatcgagaccctgaggaagaagggcttcaacggctgcgacagcccggag
cccgacggggaggactcgctggagcagagccccctgctggaggacaagtaccggcgcgcc
agcgaggagctcgacgggctcttccggcgctatgggtcagctgttccagccccaaacttt
gccatgcctgttacggtgcccgtgtccaatcagagctcacttcagttcagcaatcccagc
agctccctggtcaccccttccctggtgacgtcatccctcacggaccctcggctcctatcc
ccccagcagccagcactgcagaggaacagtgtgtctcccggcctgccccagcggccagcc
agtgcaggggccatgctggggggagacctcagcagtgctaatggagcctgtcccagccct
gttggaaatggctatgtgagtgcacgggcttcccctggcctccttccggtggccaatggc
aacagcctcaacaaagtcatccctgccaagtctccgcccccacccacccacagcgcccag
ctcggagcccccagccgcaagcccgaccttcgggtcatcacttcccagggaggaaagggg
ttaatgcatcacttgaacaatgcccagcgccttggggtctcccagtctacccactcactc
accaccccagtggtttccgtggcaacaccaagtttactcagccagggcctccccttctct
tccatgcccactgcctacaacacagactaccagttgaccagtgcagagctgtcctcctta
ccagccttcagttcacctggggggctgtcgctaggcaacgtcactgcctggcaacagcca
caacagccccagcagcctccacagccacagcctccacagccacagccacagcctcagcag
ccgcagcagccgcagccaccgcagcagccgcctcagcaacagccccacctcgtccccgtg
tctctcggcaacctgatcccgggcagcccactgccccacgtgggtgctgccctcacagtc
accacccacccccacatcagcatcaagtcagaacccgtgtcgccaagccgcgagcgcagc
cctgcgcctccccctccagctgtgttcccggctgcccgcgctgagcctggtgatggtctc
agcagcccggccgggggctcctatgagacgggagaccgggatgacggacggggagacttc
gggcccacactgggcctgctgcgcccggccccagagcaggaggctgagggctcagctgtg
aagaggatgcggctcgatacctggacattaaagtga

DBGET integrated database retrieval system