KEGG   Loxodonta africana (African savanna elephant): 100655943
Entry
100655943         CDS       T04351                                 

Gene name
KIT
Definition
(RefSeq) mast/stem cell growth factor receptor Kit isoform X2
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04072  Phospholipase D signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04640  Hematopoietic cell lineage
lav04916  Melanogenesis
lav05200  Pathways in cancer
lav05221  Acute myeloid leukemia
lav05224  Breast cancer
lav05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100655943 (KIT)
   04014 Ras signaling pathway
    100655943 (KIT)
   04015 Rap1 signaling pathway
    100655943 (KIT)
   04072 Phospholipase D signaling pathway
    100655943 (KIT)
   04151 PI3K-Akt signaling pathway
    100655943 (KIT)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100655943 (KIT)
  09152 Endocrine system
   04916 Melanogenesis
    100655943 (KIT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100655943 (KIT)
   05230 Central carbon metabolism in cancer
    100655943 (KIT)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100655943 (KIT)
   05224 Breast cancer
    100655943 (KIT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100655943 (KIT)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lav04090]
    100655943 (KIT)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100655943 (KIT)
Protein kinases [BR:lav01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100655943 (KIT)
CD molecules [BR:lav04090]
 Proteins
  100655943 (KIT)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Ig_6 Ig_4 APH C1-set
Other DBs
NCBI-GeneID: 100655943
NCBI-ProteinID: XP_003415931
LinkDB
Position
Unknown
AA seq 989 aa
MHLDKSRNVEQSSGPSAATAMRGARGAWDFLCVLLLLLRVQTGSSQPSVSPEDLSPPSIH
PAKPQLIVNVGDEIRLLCTDSGFVKWTFEILGQVSENKHNEWITEKAVATNTGNYTCTNE
GGLSSSIYVFVRDPNKLFLVSQLLYGKEGNDALVRCPLTDPEVSNYSLKGCKGKPLPKDL
VFVSDPKAGITIRSVKRTYHQLCVHCSADREGKSVLSEKFILKVRAAIKAVPSVSVSKAS
YLLREGEEFAVTCTIKDEASSVLSMWIRENSQHIKAQVQSTSRHKGDFYYERQETLTVSS
ARVNDSGVFMCYANNTFGSANVTTTLKVVDKGFIHISPIMNTTIFVNDGENLDLIVEYEA
YPKPEHQQWIYMNRTSTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGIYTFLVSNSDA
NSSVTFNVYVNTKPEILTSDRLVNGKLQCVAAGFPEPTIEWYFCPGTEQRCSPPIVPVDV
QIQNSSVSPFGRLVVQSSIDSSAFKHNGTFECKAYNDVGKNSAYFNFAFKEQIQSHTLFT
PLLIGFVIAAGMMCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWE
FPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKV
LSYLGNHMNIVNLLGACTVGGPTLVITEYCCYGDLLNFLRRKRDSFICAKQEDHAEAALY
KNLLHSKESSSCDSTNEYMDMKPGVSYVVPTKADRRRSGRIGSYIEHDVTPAIMEDDELA
LDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNY
VVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMI
KEGFRMFSPEHAPAEMYDIMKTCWDADPLKRPTFKQMVQLIEKQISDSTNHIYSNFANPS
PIPADHSVRINSVGSSASSTQPLLVHEDV
NT seq 2970 nt   +upstreamnt  +downstreamnt
atgcacttggacaagagcaggaacgtggaacagagctcaggtcccagcgcagccaccgcg
atgagaggcgctcgcggcgcctgggattttctctgcgtcctgcttctcctgctccgcgtc
cagacaggctcttctcaaccatctgtgagtccagaggatctgtctccaccatccatccat
ccagcaaaaccacagttaatagtcaatgtgggagacgagattaggctgctgtgcacagac
tcaggctttgtcaagtggacttttgagatactgggtcaagtgagtgagaataaacacaat
gaatggatcacagagaaagcagtcgccaccaacacaggcaactatacgtgcaccaatgaa
ggcggcttaagcagttccatttatgtatttgttagagatcctaacaagcttttcctggtg
agccagctgctgtacgggaaagaaggcaacgatgcattggtccgatgtccgctgacagac
ccagaggtgtccaattactcccttaagggttgcaagggaaaacctcttcccaaggacttg
gtctttgtctctgatcccaaggctggtatcactatcagaagtgtgaagcgcacttatcat
cagctttgtgtgcactgctctgcagatcgggagggaaagtcagtgctatcagagaagttc
atcctgaaagtgagggcagccatcaaagctgtaccaagtgtctctgtatccaaagcgagc
tatcttctcagggagggggaagaatttgctgtgacatgtacaataaaagatgaggctagt
tctgtgctatcgatgtggataagggaaaacagtcagcacattaaagcacaggtacaaagc
acgagccggcataagggtgacttctattatgaacgtcaggaaacgttgactgtcagctca
gcaagagttaatgattctggagtgttcatgtgttatgccaataatacttttggatcagcc
aatgtcacaacaaccttgaaagtagtagataaaggattcattcatatctctcccataatg
aatactacaatatttgtaaatgatggagaaaatttagatttaattgtcgaatacgaggca
taccccaaacctgaacaccaacagtggatatatatgaatagaacctccactgataaatgg
gaggattatcccaagtctgagaatgaaagtaatatcagatatgtaagtgaacttcatcta
accaggttaaaagggaccgagggaggcatttacacatttctagtgtccaattctgatgcc
aactcttccgtgacatttaatgtttacgtgaacacaaaaccagaaatcctgacttctgac
aggcttgtgaatggcaagctccagtgtgtggcagcaggatttccagagcccacaatagag
tggtatttttgtccaggaacggagcagaggtgctcccctcctattgtgccagtggatgtg
cagatacaaaactcatctgtgtcaccgtttggaagattagtggttcaaagttccatagat
tccagtgcatttaagcacaatggcacatttgagtgtaaggcttacaacgatgtgggcaag
aattctgcctattttaactttgcatttaaagaacaaatccagtcccataccctgttcaca
cctttgctgattgggtttgtgattgcagctggcatgatgtgtatcattgtgatgattctt
acctacaaatatttacagaaacccatgtatgaagtgcagtggaaggttgtcgaggagata
aatgggaacaattatgtttacatagacccaactcaacttccttatgatcacaaatgggag
tttcccagaaacaggctgagtttcgggaaaaccttgggtgctggagcttttgggaaagtt
gttgaggcgactgcatacggcttaattaaatcggatgcggcgatgactgtggctgtgaag
atgctcaaaccaagtgcccacttaactgagcgagaagccctaatgtctgaactcaaagtc
ctgagttatctcggtaatcatatgaacattgtgaatcttctcggagcatgcaccgttgga
ggacccaccctggtcattacagaatattgttgctatggcgatcttctgaattttttgaga
cgaaaacgtgattcatttatttgcgccaagcaggaagatcacgcagaagcagcgctttat
aagaaccttctgcattcaaaggagtcctcgtcgtgtgacagtactaatgagtacatggac
atgaaacctggagtttcttatgttgtcccaaccaaagcagacagaaggaggtctgggaga
ataggctcatacatagaacacgatgtgactcctgccatcatggaggatgacgagttggct
ctggaccttgaagacttgctgagcttttcctaccaagtagcaaagggcatggccttcctt
gcctcgaagaattgcattcatagagacttggcagccagaaatatccttcttactcatggt
cgaatcacaaaaatttgtgattttggtctagccagagacatcaagaatgactctaattat
gtggtcaaaggaaacgctcgactccctgtgaagtggatggccccggaaagcattttcaac
tgtgtgtacacatttgaaagtgatgtctggtcctacgggattttcctgtgggagctgttc
tccttaggaagcagcccctaccctgggatgccagtcgattctaagttctacaagatgatc
aaggaaggtttccggatgttcagtcccgagcatgcacctgctgaaatgtatgacatcatg
aagacttgctgggatgctgatcccctaaagaggccaaccttcaagcagatggttcagctc
atcgagaagcagatttcagatagcaccaatcatatttactccaattttgcaaaccccagc
cccatcccagcggaccattcagtgcgaatcaactccgtcggcagcagtgcttcttccacc
cagcctctgcttgtgcacgaagacgtctga

DBGET integrated database retrieval system