KEGG   Loxodonta africana (African savanna elephant): 100656003
Entry
100656003         CDS       T04351                                 

Gene name
DCT
Definition
(RefSeq) L-dopachrome tautomerase
  KO
K01827  dopachrome tautomerase [EC:5.3.3.12]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00350  Tyrosine metabolism
lav01100  Metabolic pathways
lav04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100656003 (DCT)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100656003 (DCT)
Enzymes [BR:lav01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.12  L-dopachrome isomerase
     100656003 (DCT)
SSDB
Motif
Pfam: Tyrosinase Laminin_EGF
Other DBs
NCBI-GeneID: 100656003
NCBI-ProteinID: XP_003409364
LinkDB
Position
Unknown
AA seq 462 aa
MGLLPWGLLLGCLGCGILPAAWGQFPRVCMTVGSLVSKECCPPLGGEPANLCGSQEGRGQ
CTEVQADTRPWSGRYALRNQDDREQWPRKFFNRTCRCTGNFAGYNCGDCKFGWTGSNCDR
KKPPVVRKNIHSLTPQEREQFLGAMDLAKNTTHPDYVITTQHWLGLLGPNGTQPQIANCS
IYDYFVWLHYYSVRDTLLGPGRPYKAADFSHRGPAFVTWHRYHLLLLERDLQRLTGNESF
ALPYWNFATGRNECDVCTDQLFGAARQDDPTLISQNSRFSSWEIVCDSLDDYNRRVTLCN
GTYEGLLRRNQVGRNNEKLPTLEDIRDCLSLVKFDNPPYFQNSSFSFRNALEGFDKADGT
LDSRVMSLHNLVHSFLNGTNALPHSAANDPVFVVLHSFTDAIFDEWMKRFKPPIDAWPQE
LAPIGHNRMYNMVPFFPPVTNEELFLTADQLGYSYTIDLTGN
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggcctccttccgtgggggcttctgttgggttgcctgggctgtggaatcctgcctgca
gcctggggtcagttcccccgggtctgcatgacggtgggcagcctggtgtccaaggagtgc
tgcccgccgctgggcggggagcccgccaacctctgtggttcccaggagggccgggggcag
tgcacggaggtccaagcagacaccaggccgtggagtggccgctatgccctgaggaaccag
gatgaccgcgagcagtggcccaggaagttctttaaccggacctgcaggtgcacaggaaac
tttgctggctataactgtggagactgcaagtttggctggactggctccaactgtgatcgg
aagaaaccaccagttgttcggaaaaacatccattccctgactcctcaggagagggagcag
ttcctgggagcaatggaccttgcaaagaacaccacgcaccccgactacgtgatcaccacg
cagcactggctgggcctgctcgggcccaatggaacccagccacaaattgccaactgcagt
atttatgattactttgtgtggcttcattattattctgttagagatacattattaggacca
gggcgcccatacaaggctgcagatttctcccaccgaggacctgcctttgtgacctggcac
cggtaccatttgttgttgctggaaagagatcttcagcgactgactggcaatgagtccttt
gctttgccctactggaactttgctactgggagaaacgagtgtgacgtgtgtacagaccag
ctgttcggggcagccagacaagatgatccaactctgattagtcagaactcaagattctcc
agctgggaaattgtctgtgacagcttggatgactacaaccgccgtgtcaccttgtgtaat
ggaacctatgaaggtttgctgagaagaaatcaagtgggaagaaacaatgagaaattacca
accttagaagacatacgagactgtctgtccctcgttaagtttgacaatcctccttacttc
cagaattctagcttcagcttcaggaacgccctggaagggtttgataaagcagatgggaca
ctggattcccgagtgatgagcctccataatttggtccattccttcctgaatgggacaaac
gctttgccacattctgctgccaatgatcctgtttttgtggtccttcattcttttactgac
gccatttttgatgagtggatgaaaaggtttaagcctcctattgatgcctggcctcaggag
ctggcacccattggccacaatcggatgtataacatggtgcctttcttccctccagtaact
aatgaggaactctttctaactgcagaccaacttggctacagctacaccattgacctgaca
ggtaactaa

DBGET integrated database retrieval system