KEGG   Loxodonta africana (African savanna elephant): 100656041
Entry
100656041         CDS       T04351                                 

Gene name
KCNJ1
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 1
  KO
K04995  potassium inwardly-rectifying channel subfamily J member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04960  Aldosterone-regulated sodium reabsorption
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100656041 (KCNJ1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100656041 (KCNJ1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100656041 (KCNJ1)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100656041 (KCNJ1)
SSDB
Motif
Pfam: IRK_C IRK
Other DBs
NCBI-GeneID: 100656041
NCBI-ProteinID: XP_003417463
LinkDB
Position
Unknown
AA seq 372 aa
MFKYLRKWFVTRFFGHTRQRARLVSKDGRCNIEFGNVEAQWRFIFFVDIWTTVLDLKWRY
KMTFFISVFLGSWFLFGLLWYAVAYIHKDLPEFHPSVNHTPCVENINGLTSAFLFSLETQ
VTIGYGFRCVTEKCGPAIFLLIFQSILGVIINSFMCGAILAKISRPKKRAKTITFSKNAV
ISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQTNINFVVDAGNEN
LFFISPLTIYHIIDHNSPFFHMAAENLSQQDFELVVFLDGTVESTSATCQVRTSYVPEEV
LWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDDRARMKRGYDNPNFI
LSEVNETDDTKM
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgttcaaatatcttcggaaatggtttgtcactcgcttcttcgggcatacccggcagaga
gcaaggctggtctccaaagatggaaggtgcaacatagagtttggcaatgtggaggcacaa
tggcggtttatattctttgtggatatatggacaactgtgcttgacctcaaatggagatac
aagatgacctttttcatctctgtcttcttggggagctggttcctctttggtcttctgtgg
tatgcagtagcctacattcacaaagatctcccagagtttcatccttctgtcaatcataca
ccatgtgtggagaacataaatggcttgacttcagcttttctcttttctctggaaactcaa
gtgaccattggatatggattcaggtgtgtgacagaaaaatgtggtcctgccatttttcta
cttattttccagtctatccttggagtcattatcaattctttcatgtgtggtgccatttta
gccaagatctccagacccaagaaacgtgcaaagaccattaccttcagcaagaatgcagtg
atcagcaagcggggtgggaaactctgtctcctaatccgagtggctaatcttagaaagagc
ctccttattggcagccacatatatggaaagcttctgaagaccacagtcactcctgaggga
gagactattattttggaccagaccaatatcaattttgtggtagatgctggtaatgaaaat
ttattcttcatctccccactgactatttaccatatcattgatcacaacagcccttttttc
cacatggcagcagaaaacctttcccagcaggactttgaattagtggtgtttttagatgga
acagtggaatcaaccagtgctacctgccaggtccggacatcctatgtcccagaggaggtg
ctttggggctaccgttttgctcccatagtgtccaagaccaaggaggggaaataccgagta
gacttccataattttagcaagacagtagaagtggagacccctcactgtgccatgtgcctc
tataatgagaaagatgatagagccaggatgaagagaggctatgataaccccaactttatc
ttgtcagaagtcaatgaaacagatgacaccaaaatgtaa

KEGG   Loxodonta africana (African savanna elephant): 100661939
Entry
100661939         CDS       T04351                                 

Gene name
KCNJ2
Definition
(RefSeq) inward rectifier potassium channel 2
  KO
K04996  potassium inwardly-rectifying channel subfamily J member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04725  Cholinergic synapse
lav04921  Oxytocin signaling pathway
lav04924  Renin secretion
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100661939 (KCNJ2)
   04924 Renin secretion
    100661939 (KCNJ2)
  09154 Digestive system
   04971 Gastric acid secretion
    100661939 (KCNJ2)
  09156 Nervous system
   04725 Cholinergic synapse
    100661939 (KCNJ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100661939 (KCNJ2)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100661939 (KCNJ2)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 100661939
NCBI-ProteinID: XP_010595294
UniProt: G3SZK9
LinkDB
Position
Unknown
AA seq 427 aa
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFILSWLFFGCVFWLIALLHGDLDASKESK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEDDSENGLPESTSTDTPPDIDLHNQASVPLEPRP
LRRESEI
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgggcagtgtgcgaaccaaccgctatagcattgtctcttcggaagaagacggcatgaag
ttggccaccatggcagtggcaaatggctttgggaacgggaagagtaaagtccacactcga
cagcagtgcaggagccgctttgtgaagaaagatggccactgtaatgttcagttcatcaac
gtgggggagaaaggacaacggtacttggcagacatctttaccacgtgtgtggacatccgc
tggcggtggatgctggttatcttctgcctggctttcattctctcgtggctgttttttggc
tgtgtgttttggctgatagctctgctccatggggacctggatgcatcgaaggagagcaaa
gcttgtgtgtctgaggtcaatagcttcaccgctgccttcctcttctccattgagacccag
acaacaataggctatggcttcaggtgtgttactgacgaatgcccgattgctgttttcatg
gtggtgttccaatcgattgtgggctgcatcatcgatgccttcatcattggtgctgtcatg
gcgaagatggcaaagccaaagaagagaaatgagactctcgtcttcagtcacaatgctgtg
attgccatgagagatggcaagctatgtttgatgtggcgagtgggcaatcttcggaagagc
catttggtggaagctcacgttcgagcacagctcctcaaatccagaattacttctgaaggg
gagtatatcccactggatcaaatagacatcaatgttgggttcgacagtggaattgaccgt
atatttctggtgtccccaatcacaatagtccacgaaatagatgaggacagtcctttatat
gatttaagtaaacaggatattgacaatgcagactttgaaatcgtggtaatactggaaggc
atggtggaagccaccgccatgacaacacaatgtcgtagctcttacctggcaaacgaaatc
ctttggggccaccgctatgagcctgtactctttgaagagaagcactactacaaagtggac
tattcaaggttccacaaaacatatgaagtacccaacactcccctttgtagtgccagagac
ttagcggaaaagaaatatatcctctcaaatgcaaattcattttgctatgaaaatgaagtt
gccctcacaagcaaagaggaagatgacagtgaaaatggacttccagaaagcactagtaca
gacactccccctgacatagaccttcacaaccaggcaagtgtacctctagagcccaggccc
ttacggcgagaatcagagatatga

KEGG   Loxodonta africana (African savanna elephant): 100662226
Entry
100662226         CDS       T04351                                 

Gene name
KCNJ16
Definition
(RefSeq) inward rectifier potassium channel 16
  KO
K05009  potassium inwardly-rectifying channel subfamily J member 16
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100662226 (KCNJ16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100662226 (KCNJ16)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100662226 (KCNJ16)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2 DUF536
Other DBs
NCBI-GeneID: 100662226
NCBI-ProteinID: XP_003417333
UniProt: G3U5D1
LinkDB
Position
Unknown
AA seq 419 aa
MSYYGGGHRIVNVNPKYPFYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYMVD
IFTTLVDTKWRHMFVIFSLSYILSWLIFGTIFWLIAFHHGDLLNDPAVTPCVDNVHSFTG
AFLFSLETQTTIGYGYRCVTEECSMAVLMVIIQSILSCIINTFIIGAALAKMATARKRAQ
TIRFSYFALIGMRDGKLCLTWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKL
VNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV
PREILWGHRFHDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLQNMEKAPPV
QGSSTSDTKVRRRSFSAVAIVSSCENPEEPTTSAVDECKEVPYQKALVTLNRITVESQM
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagctattacggtggcggccatcggattgtaaacgtgaaccctaaatatccattctac
cccccagaacacattatagctgagaaaagaagagcaagaagacgcctgctccacaaagat
ggcagttgtaatgtgtatttcaagcacatttttggagaatggggaagctatatggtcgac
attttcaccactcttgtggacaccaagtggcgccatatgtttgttatattttctttgtct
tatattctttcctggttgatttttggcactatcttttggctaatagcctttcatcatgga
gatctattgaatgatccagccgtcacaccttgtgtggacaacgtccattctttcacaggg
gcgtttttgttctccctggagacccagaccaccataggttatggctaccgctgtgtcact
gaagaatgttctatggcagtgctcatggtgatcattcagtccatcttaagctgcatcata
aataccttcatcattggagctgccttggccaaaatggcaactgctcgaaagagagcgcag
accattcggtttagctattttgcactcataggcatgagagatgggaagctttgcctcacg
tggcgcattggtgatttccgaccaaaccatgtggtagaaggaacagtaagagcccaactt
ctccgctacacagaagacagcgaaggacggatgacaatggcatttaaagacctaaagtta
gtcaatgaccagatcatccttgtcacaccagtaactattgttcatgaaattgaccatgag
agccctctttatgcccttgaccgcaaagcagtggccaaagacaactttgagattttggtg
acattcatctatactggtgattctactggaacatctcaccaatccagaagttcctatgtc
ccccgagaaattctctggggccacaggtttcatgatgtcttggaagttaagagaaagtat
tacaaagtgaactgcttacagtttgaggggagtgttgaagtttatgctcctttttgcagt
gctaaacaattggattggaaagatcagcagctccaaaacatggaaaaagcaccaccagtc
caaggatccagcacttcagacaccaaggtcaggcgaaggtcatttagtgcagttgccatt
gtcagcagctgtgaaaaccccgaggagcccactacctctgccgtggatgagtgtaaggaa
gtgccttatcagaaagccctcgtaactttaaatagaatcactgtagaatcccaaatgtag

KEGG   Loxodonta africana (African savanna elephant): 100667816
Entry
100667816         CDS       T04351                                 

Gene name
KCNJ15
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 15
  KO
K05008  potassium inwardly-rectifying channel subfamily J member 15
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100667816 (KCNJ15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100667816 (KCNJ15)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100667816 (KCNJ15)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2 DUF2182
Other DBs
NCBI-GeneID: 100667816
NCBI-ProteinID: XP_023414947
LinkDB
Position
Unknown
AA seq 375 aa
MDTIHINMSSAPLVKHAAGAELKTNRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPSVHTSNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQKLEEKYRQEDQ
RERELRTLLLQQSNV
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggacaccattcacattaacatgtccagtgctcccctggtgaagcatgctgctggagct
gaactcaagaccaacagaccccgagtcatgtccaaaagtggacacagcaatgtgagaatc
gacaaagtggatggcatatacctgctgtatcttcaggacttgtggaccactgttatcgac
atgaagtggagatacaaactcactctgtttgcagccactttcgtgatgacctggttcctc
tttggggtgatctactatgccattgcatttattcacggggacttggagccaagtgtgcac
acttccaatcacactccctgcatcatgaaagtggactctttaacaggggcattcctcttt
tccctggagtctcagacaaccattggctacggagtccgctccatcactgaggaatgcccg
cacgccattttcctgctggttgctcagctggtcatcacgaccttgattgagattttcatc
accggcacctttctggccaaaattgcaagacccaaaaagcgagctgagaccatcaagttc
agccactgtgccgtcatcaccaagcagaatgggaagctctgcttggtgatccaggtggcc
aacatgaggaagagtctcctgatccagtgccagctctctggcaagctcctgcagacgcac
gtcaccaaggagggggagcggatccttctcaaccaagccaccgtcaagttccacgtggac
tcctcctctgagagccccttcctcattttacccatgacgttctaccatgtgctggatgag
acaagccccctgagagacctcacaccccaaaacctgaaagagaaggagtttgaactggtg
gttctcctcaatgccaccgtagaatccaccagtgcggtctgccagagccggacatcgtac
atcccagaggagatctactggggttttgagtttgtgcctgtcgtttctctctccaaaaat
ggaaaatatgtggctgatttcagtcagttcgaacagatccggaagagcccagactgtacc
ttctactgtgcggattcagagaagcagaaacttgaggaaaagtacaggcaggaagatcag
agagaaagagaactgaggacacttttgctacaacagagcaatgtctga

KEGG   Loxodonta africana (African savanna elephant): 100673497
Entry
100673497         CDS       T04351                                 

Gene name
KCNJ10
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 10
  KO
K05003  potassium inwardly-rectifying channel subfamily J member 10
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04971  Gastric acid secretion
lav05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    100673497 (KCNJ10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100673497 (KCNJ10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100673497 (KCNJ10)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100673497 (KCNJ10)
SSDB
Motif
Pfam: IRK_C IRK DUF2182 Ion_trans_2
Other DBs
NCBI-GeneID: 100673497
NCBI-ProteinID: XP_003415227
UniProt: G3TW00
LinkDB
Position
Unknown
AA seq 378 aa
MTSVAKVYYSQTTQTECRPLMVPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVVHGDLLELGPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVATHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVIDETSPLKDLPLRSGEGDFELVVILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDEVVKVAPPSGLRDSTIRYGDPEKLRLEES
LREQAEEGSALSVRISNV
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgacatccgttgccaaggtgtattacagtcagaccactcagacagaatgccggccccta
atggtcccaggaatacgacggcggagagtcctcacaaaggatggtcgcagcaatgtaagg
atggaacacattgctgacaagcgcttcctctacctcaaagacctgtggacaaccttcatt
gacatgcagtggcgctacaagcttctgctcttctctgcaacctttgcaggcacctggttc
ctctttggcgtggtgtggtatctggtagctgtggtccatggagacctgctggagctgggc
cccccagccaaccatacgccatgtgtggtacaggtgcacacactcactggggctttcctc
ttctccctcgaatcccagaccactattggctatgggttccgttacatcagtgaggagtgc
ccactggctattgtgcttcttattgcccagctggtgctcaccaccattctggagatcttc
atcacaggaaccttcctggccaagattgcccggcccaagaagcgggctgagaccatccgt
ttcagccagcatgcagttgtagccacccacaatgggaagccctgccttatgatccgagtt
gccaatatgcgtaagagcctcctcataggctgccaggtgacaggcaaactgcttcagacc
caccagaccaaggaaggtgagaacatccggctcaaccaggtcaatgtgactttccaagta
gacacagcctctgacagccccttcctcattttaccccttaccttctaccacgtgatagat
gagaccagtcccttgaaagatctcccccttcgcagtggtgaaggtgactttgagctggtg
gtgattctaagtgggacagtggagtccactagtgccacctgccaggtgcgcacttcctac
ctgccagaagagatcctttggggctacgagttcacacctgccatctcactgtcagccagt
ggcaaatacatagctgacttcagcctttttgacgaggttgtgaaagtggcccctcctagt
ggcctccgtgacagcaccatacgctatggagacccagaaaagctcaggttggaggagtca
ttaagggagcaagctgaggagggcagtgcccttagtgtgcgcatcagtaacgtctga

DBGET integrated database retrieval system