KEGG   Loxodonta africana (African savanna elephant): 100656090
Entry
100656090         CDS       T04351                                 

Gene name
TYMP
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00240  Pyrimidine metabolism
lav00983  Drug metabolism - other enzymes
lav01100  Metabolic pathways
lav05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    100656090 (TYMP)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100656090 (TYMP)
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    100656090 (TYMP)
Enzymes [BR:lav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     100656090 (TYMP)
SSDB
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Other DBs
NCBI-GeneID: 100656090
NCBI-ProteinID: XP_003423234
LinkDB
Position
Unknown
AA seq 306 aa
MEAPGTPRPPGLLAGGGSQGPANPAPEPKQVPELIRLKRDGSRLSEADIRGFVRAVVDGS
AQAVQIGAMLMAIRLRGMDLEETTALTRALAESGQRLEWPEAWQGQLVDKHSTGGVGDKV
SLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFTVIQSPEQMQELLEQVGCCIV
SQSEKLVPADGILYAARDVTATVDSLPLVTASILSKKAVEGLMALVVDVKFGGAAIFPSE
VQARELAKTLVEVGAGLGLRVAAALTSMDTPLGRSVGHTLEVEEALLCMDGAGPPDLRDL
VTRLGS
NT seq 921 nt   +upstreamnt  +downstreamnt
atggaagctccagggaccccacgacctcctggtctcctcgcgggcggagggagtcagggc
cctgctaaccccgctcccgagccgaagcaggtccccgagctgatccgcctgaagcgagac
ggaagccgcctgagcgaggcggacattaggggattcgtgcgcgccgtggtggacgggagt
gcgcaggccgtgcagatcggggccatgctcatggccatccgacttcggggcatggacctg
gaggagaccacagcgctgacccgggccctggccgaatcggggcagcggctggagtggcca
gaggcctggcaggggcagctcgtggacaaacattccacagggggcgtgggtgacaaggtc
agcctggtcctggcacctgccctggctgcctgtggctgcaaggtgccaatgatcagcgga
cgtggtcttgggcacacggggggcaccctggataagctggagtctattcctggattcact
gtcatccaaagcccagagcagatgcaagagctcctggagcaagtgggctgctgtatcgtg
agccagagtgagaagctggttcctgcagacggaatcctgtatgcagccagggatgtgacc
gccactgtggatagcctgccccttgtcacagcctccatcctcagtaagaaggcagtggaa
ggactcatggctctggtggtggatgtgaagttcgggggtgctgcaatcttccccagtgag
gtccaggcccgggagctggcaaagactctggtggaagtgggggcaggcctggggcttcgg
gttgcggccgccctgacctccatggacacccctctgggccgaagcgtgggccacacgctg
gaggtagaggaggcgctgctttgcatggacggcgccgggcccccagacctgcgggacctg
gtcacccgactaggttcctga

DBGET integrated database retrieval system