KEGG   Loxodonta africana (African savanna elephant): 100656098
Entry
100656098         CDS       T04351                                 

Gene name
RRAS
Definition
(RefSeq) ras-related protein R-Ras isoform X3
  KO
K07829  Ras-related protein R-Ras
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04072  Phospholipase D signaling pathway
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04218  Cellular senescence
lav04360  Axon guidance
lav04371  Apelin signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04810  Regulation of actin cytoskeleton
lav05132  Salmonella infection
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100656098 (RRAS)
   04014 Ras signaling pathway
    100656098 (RRAS)
   04015 Rap1 signaling pathway
    100656098 (RRAS)
   04371 Apelin signaling pathway
    100656098 (RRAS)
   04072 Phospholipase D signaling pathway
    100656098 (RRAS)
   04024 cAMP signaling pathway
    100656098 (RRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100656098 (RRAS)
   04137 Mitophagy - animal
    100656098 (RRAS)
  09143 Cell growth and death
   04218 Cellular senescence
    100656098 (RRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100656098 (RRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100656098 (RRAS)
  09158 Development and regeneration
   04360 Axon guidance
    100656098 (RRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100656098 (RRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100656098 (RRAS)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100656098 (RRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 AAA_22 SRPRB Abhydrolase_4 Ribosomal_S30AE
Other DBs
NCBI-GeneID: 100656098
NCBI-ProteinID: XP_003406857
LinkDB
Position
Unknown
AA seq 218 aa
MSSGAVSGTGRGRPRGGGPGPGDPPPNETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP
TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVS
KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASAFSASHHVAYFEASAKLRLNVD
EAFEQLVRAVRKYQEQELPSYPPSAPGKKDGGCPCILL
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagcagcggggcggtgtccgggacggggcgggggcggccccggggcggggggccggga
cccggggaccccccacccaacgagacacacaagctggtggtcgtgggcggcggcggcgtg
ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactatgacccc
accatcgaggactcctacactaagatctgcacagtggatggcgtccctgcccgactggac
atcctggacaccgcaggccaggaggagtttggcgccatgcgggagcaatacatgcgtgct
ggccacggcttcctgctggtgtttgccatcaatgaccggcagagtttcaatgaggtgagc
aagctgttcacgcaaatcctccgcgtcaaggaccgagatgacttccccatagtgctggtt
gggaacaaggcagacctggagacccaacgccaggtcccccgatctgaagcctctgccttc
agtgcctcccaccacgtggcctacttcgaggcctctgccaaactgcgcctcaacgtggac
gaggcctttgagcagctggttcgggcagtccggaaataccaggaacaagagcttccatcc
tatccgcccagtgccccaggcaagaaagatggggggtgcccctgcatcctcctgtag

KEGG   Loxodonta africana (African savanna elephant): 100661156
Entry
100661156         CDS       T04351                                 

Gene name
RRAS2
Definition
(RefSeq) ras-related protein R-Ras2 isoform X1
  KO
K07830  Ras-related protein R-Ras2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04024  cAMP signaling pathway
lav04072  Phospholipase D signaling pathway
lav04137  Mitophagy - animal
lav04140  Autophagy - animal
lav04218  Cellular senescence
lav04371  Apelin signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04810  Regulation of actin cytoskeleton
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100661156 (RRAS2)
   04014 Ras signaling pathway
    100661156 (RRAS2)
   04371 Apelin signaling pathway
    100661156 (RRAS2)
   04072 Phospholipase D signaling pathway
    100661156 (RRAS2)
   04024 cAMP signaling pathway
    100661156 (RRAS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100661156 (RRAS2)
   04137 Mitophagy - animal
    100661156 (RRAS2)
  09143 Cell growth and death
   04218 Cellular senescence
    100661156 (RRAS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100661156 (RRAS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100661156 (RRAS2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100661156 (RRAS2)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100661156 (RRAS2)
  Exosomal proteins of bladder cancer cells
   100661156 (RRAS2)
GTP-binding proteins [BR:lav04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100661156 (RRAS2)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf ATP_bind_1
Other DBs
NCBI-GeneID: 100661156
NCBI-ProteinID: XP_023406589
LinkDB
Position
Unknown
AA seq 180 aa
MAVDVALDHPVESYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMR
TGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQ
LARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
NT seq 543 nt   +upstreamnt  +downstreamnt
atggctgttgatgttgcccttgaccacccggttgagtcctattttgtaacggattatgat
ccaaccattgaagattcctatacaaagcagtgtgtgattgacgatagagcggcccggcta
gatattctggatacagcaggacaagaagagtttggagctatgagagaacagtacatgagg
actggagagggtttcctgctggtcttttcagtcacagatagaggcagttttgaagaaatc
tataaatttcaaagacagattctcagagtaaaggatcgtgatgagtttccaatgatctta
attggtaataaagcagacctggatcatcaaagacaggtgacacaggaagaaggacagcag
ttagcacggcaacttaaggtaacatacatggaggcttctgcaaagattaggatgaatgta
gatcaagctttccatgagcttgtccgggtgataaggaaatttcaagagcaagaatgtccc
ccttctccagaaccaacgcggaaagaaaaagacaagaaaggttgccattgtgtcattttc
taa

DBGET integrated database retrieval system