KEGG   Loxodonta africana (African savanna elephant): 100656106
Entry
100656106         CDS       T04351                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X22
  KO
K04491  transcription factor 7-like 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04520  Adherens junction
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05132  Salmonella infection
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05213  Endometrial cancer
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05217  Basal cell carcinoma
lav05221  Acute myeloid leukemia
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100656106 (TCF7L2)
   04390 Hippo signaling pathway
    100656106 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100656106 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100656106 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100656106 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100656106 (TCF7L2)
   05225 Hepatocellular carcinoma
    100656106 (TCF7L2)
   05226 Gastric cancer
    100656106 (TCF7L2)
   05216 Thyroid cancer
    100656106 (TCF7L2)
   05221 Acute myeloid leukemia
    100656106 (TCF7L2)
   05217 Basal cell carcinoma
    100656106 (TCF7L2)
   05215 Prostate cancer
    100656106 (TCF7L2)
   05213 Endometrial cancer
    100656106 (TCF7L2)
   05224 Breast cancer
    100656106 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100656106 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100656106 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100656106 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100656106 (TCF7L2)
   05165 Human papillomavirus infection
    100656106 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100656106 (TCF7L2)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100656106 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100656106
NCBI-ProteinID: XP_010587286
LinkDB
Position
Unknown
AA seq 438 aa
MSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYY
PLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHT
LHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKE
MRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNY
GKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRK
KKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPHDAKSQTEQTQPLSLSLKPDPL
AHLSMMPPPPALLLAEAAHGKAPALCPNGALDLPPASLQPPIAPSSSLAQPSTSSLHSHT
ALAGTQPQPLSLVTKSLE
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgtcgaacaaagtgccagttgtgcagcacccccaccacgtacaccctctcacgcctctc
attacgtacagcaatgaacacttcaccccaggaaaccctcctccacacttaccagccgac
gtagaccccaaaacaggaatcccacggcctccgcaccctccagatatatctccgtattac
ccactatcgcctggcactgtaggacaaatcccccatccgctaggatggttagtaccacag
caaggtcagcccgtgtatccaatcacgacaggaggattcagacacccctacccaacagct
ctgaccgtcaacgcttccatgtccaggttcccaccccatatggtcccaccacatcatact
ctacacacgactggcattccccacccggccatcgtcacaccaacggtcaaacaggaatcc
tcccagagtgacgtcggctcactgcatagctcaaagcatcaggactccaaaaaggaagaa
gaaaagaagaagccccacataaagaaacctcttaacgcattcatgttgtatatgaaggaa
atgagagcaaaggtcgtggctgagtgcacgttgaaagaaagcgcggccatcaaccagatc
ctggggcggaggtggcacgcattgtccagagaagagcaggcgaagtactacgagctagcc
cggaaggaacgacaactccatatgcagctgtacccaggctggtccgcacgggataactac
gggaagaagaagaagaggaaaagggataagcagccgggagagaccaatgaacacagcgaa
tgtttcctaaatccttgcctttcacttcctccgattacagacctgagcgctcctaagaaa
tgccgagcgcgctttggccttgatcaacagaataactggtgcggcccttgcaggagaaaa
aaaaagtgcgttcgctacatacaaggtgaaggcagctgcctcagcccaccctcttcagat
ggaagcttactagactcgcctcctccctctcccaacctgctaggctcccctccccacgat
gccaagtcacagactgagcagacccagcctctctcgctctccctgaagcccgaccccctg
gcccacctgtccatgatgcctccgccacccgccctcctcctcgccgaggccgcccacggc
aaggcccctgccctctgtcccaacggggccctggacctgccgcccgcctctttgcagcca
cccatcgcaccctcctcatctcttgcacagccgtcgacatcttccttacattcccacact
gcgctggccgggacccaaccccagccgctgtccctcgtcaccaagtctttagaatag

KEGG   Loxodonta africana (African savanna elephant): 100658960
Entry
100658960         CDS       T04351                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X2
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04520  Adherens junction
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05132  Salmonella infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05213  Endometrial cancer
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05217  Basal cell carcinoma
lav05221  Acute myeloid leukemia
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100658960 (LEF1)
   04390 Hippo signaling pathway
    100658960 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100658960 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100658960 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100658960 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100658960 (LEF1)
   05225 Hepatocellular carcinoma
    100658960 (LEF1)
   05226 Gastric cancer
    100658960 (LEF1)
   05216 Thyroid cancer
    100658960 (LEF1)
   05221 Acute myeloid leukemia
    100658960 (LEF1)
   05217 Basal cell carcinoma
    100658960 (LEF1)
   05215 Prostate cancer
    100658960 (LEF1)
   05213 Endometrial cancer
    100658960 (LEF1)
   05224 Breast cancer
    100658960 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100658960 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100658960 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100658960 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100658960 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100658960 (LEF1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100658960 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100658960
NCBI-ProteinID: XP_003410438
UniProt: G3TH00
LinkDB
Position
Unknown
AA seq 399 aa
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQESYHDKAREHPDEGKHPDGGLYNKGPSYSGYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMPRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgccccagctctccgggggaggcggtggcggcgggggggacccggaactctgcgccacg
gacgagatgatcccctttaaggacgagggcgacccccagaaggagaagatcttcgccgag
atcagtcaccccgaagaggaaggcgacttagccgacatcaagtcttccttggtcaatgaa
tccgaaatcatcccagccagcaacggacacgaggtggccagacaagctcaaacctctcag
gagtcctaccatgacaaggccagagaacaccctgatgaaggaaagcatccagatggaggc
ctctacaacaagggaccctcctactcgggttattccgggtacataatgatgccaaacatg
aataacgacccatacatgtcaaatggatctctttctccgcccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcggtccaccctctcacccccctcatcacttac
agtgacgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aaacaagggatgcccagacatcctccggctcctgatatccccaccttttatcccctgtct
ccgggtggcgttgggcagattaccccacctcttggctggcaaggtcagcctgtatatccc
atcacgggtggattcaggcaaccctacccatcctcactgtctgtcgacacttccatgtcc
aggttttcccatcatatgattcctggtcctcctggtccccacacaactggcatccctcat
ccagctatcgtaacgcctcaggtcaaacaggagcatccccacactgacagtgacctaatg
cacgtgaagcctcagcatgaacagagaaaggagcaggagccaaaaagacctcacattaag
aaacctctgaatgcttttatgttatacatgaaagaaatgagagcaaatgtcgtagctgag
tgtactctaaaggaaagtgcagctatcaaccagatcctaggcagaaggtggcatgccctc
tcccgtgaagagcaggctaaatattatgaattagcgcggaaggagagacagctccatatg
cagctttacccaggctggtctgccagagacaattatggtaagaaaaagaagaggaagaga
gagaagctacaggaatctacatcaggtacaggtccaagaatgacagctgcctacatctga

KEGG   Loxodonta africana (African savanna elephant): 100663559
Entry
100663559         CDS       T04351                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X3
  KO
K02620  transcription factor 7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04310  Wnt signaling pathway
lav04390  Hippo signaling pathway
lav04520  Adherens junction
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05132  Salmonella infection
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05213  Endometrial cancer
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05217  Basal cell carcinoma
lav05221  Acute myeloid leukemia
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100663559 (TCF7)
   04390 Hippo signaling pathway
    100663559 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100663559 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    100663559 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100663559 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100663559 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100663559 (TCF7)
   05225 Hepatocellular carcinoma
    100663559 (TCF7)
   05226 Gastric cancer
    100663559 (TCF7)
   05216 Thyroid cancer
    100663559 (TCF7)
   05221 Acute myeloid leukemia
    100663559 (TCF7)
   05217 Basal cell carcinoma
    100663559 (TCF7)
   05215 Prostate cancer
    100663559 (TCF7)
   05213 Endometrial cancer
    100663559 (TCF7)
   05224 Breast cancer
    100663559 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100663559 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100663559 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100663559 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100663559 (TCF7)
   05165 Human papillomavirus infection
    100663559 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100663559 (TCF7)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100663559 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NPIP
Other DBs
NCBI-GeneID: 100663559
NCBI-ProteinID: XP_003404540
LinkDB
Position
Unknown
AA seq 382 aa
MPQLDSGGGSAGGGDDLGAPDELLAFQDEGEEQDKSRDSAAGPERDLAELKSSLVNESEG
AAGGAGVPGTGAEAEARAEALGREHTSQRLFSDKLPESLEDGLKAPECVSGMYKETVYSA
FNLLMHYPPPSGAGQHPQPQPPLHNKASQPPHGVPQLSPLYEHFSSPHPTPAPADINQKQ
VHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGK
QELQPYDRSLKTQAEAKVEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQI
LGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESNTGGKR
NAFGTYPEKAAAPAQFLPMTVL
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgccgcagctggactcgggcgggggaagcgcgggcggcggcgacgacctcggcgcgccc
gacgagctgctggccttccaggacgagggcgaggagcaggacaagagccgcgacagtgcc
gcgggccccgagcgcgacctggccgagctcaagtcgtctctagtcaacgaatccgagggc
gcggccgggggcgcgggggtcccggggaccggcgccgaggccgaagcccgggccgaggcg
ctcgggcgggaacacacttcgcagagacttttctcggacaaacttccagagtctctggag
gacggcctgaaggccccagagtgtgttagcggcatgtacaaagagaccgtctactcagcc
ttcaatctgctcatgcactacccacccccctcgggagcagggcagcacccccagccgcaa
cccccgctgcacaacaaggctagtcagcccccccacggagtcccccaactctctcctctc
tatgaacatttcagcagcccacaccccacacctgcgcctgccgacatcaaccagaagcaa
gttcacaggcccctgcagacccctgacctgtctggcttctactctctgacctcaggcagc
atgggacagctcccccacactgtgagctggttcacccacccgtccttgatgctaggctct
ggcgtacctggccaccccgcagccatcccccacccagccattgtgcccccctcagggaag
caggagctgcagccctatgaccggagcctgaagacccaagcagaggccaaggtggagaag
gaggccaagaagccaaccatcaagaagccactgaatgccttcatgctgtacatgaaggag
atgagagccaaggtcatcgcagagtgcacactcaaggaaagcgctgccatcaaccagatc
ctgggacgcaggtggcacgcgctgtctcgggaagagcaagccaagtattatgagctggcc
cgcaaagagaggcagctgcacatgcagctctacccaggctggtcggcgcgggacaactat
ggaaagaagaagaggcgctcaagggaaaagcaccaagaatccaacacaggaggaaaaaga
aatgcattcggtacttacccggagaaggccgctgccccagcccagttccttccgatgaca
gtgctctag

DBGET integrated database retrieval system