KEGG   Loxodonta africana (African savanna elephant): 100656123
Entry
100656123         CDS       T04351                                 

Gene name
SST
Definition
(RefSeq) somatostatin
  KO
K05237  somatostatin
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04935  Growth hormone synthesis, secretion and action
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100656123 (SST)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100656123 (SST)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100656123 (SST)
  09154 Digestive system
   04971 Gastric acid secretion
    100656123 (SST)
SSDB
Motif
Pfam: Somatostatin
Other DBs
NCBI-GeneID: 100656123
NCBI-ProteinID: XP_003412958
UniProt: G3T956
LinkDB
Position
Unknown
AA seq 116 aa
MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgctgtcctgccgcctccagtgcgcgctggccgcgctttccatcgtcctggccctgggc
ggtgtcaccggagcgccctcggaccccagactccgccagtttctgcagaagtccctcgct
gctgccgctgggaagcaggagctggccaagtacttcttggcagaactgctgtctgaaccc
aaccagacggagaatgatgccctggaacctgaagacctgtcccaggctgctgagcaggat
gaaatgaggctggagctgcagagatctgctaactcaaatccagccatggcaccccgagaa
cgtaaagctggctgcaagaatttcttctggaagaccttcacatcctgttag

DBGET integrated database retrieval system