KEGG   Loxodonta africana (African savanna elephant): 100656260Help
Entry
100656260         CDS       T04351                                 

Gene name
ALDH7A1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase isoform X1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00010  Glycolysis / Gluconeogenesis
lav00053  Ascorbate and aldarate metabolism
lav00071  Fatty acid degradation
lav00260  Glycine, serine and threonine metabolism
lav00280  Valine, leucine and isoleucine degradation
lav00310  Lysine degradation
lav00330  Arginine and proline metabolism
lav00340  Histidine metabolism
lav00380  Tryptophan metabolism
lav00410  beta-Alanine metabolism
lav00561  Glycerolipid metabolism
lav00620  Pyruvate metabolism
lav01100  Metabolic pathways
Module
lav_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
lav_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100656260 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    100656260 (ALDH7A1)
   00620 Pyruvate metabolism
    100656260 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100656260 (ALDH7A1)
   00561 Glycerolipid metabolism
    100656260 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100656260 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    100656260 (ALDH7A1)
   00310 Lysine degradation
    100656260 (ALDH7A1)
   00330 Arginine and proline metabolism
    100656260 (ALDH7A1)
   00340 Histidine metabolism
    100656260 (ALDH7A1)
   00380 Tryptophan metabolism
    100656260 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100656260 (ALDH7A1)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100656260 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     100656260 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     100656260 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100656260
NCBI-ProteinID: XP_003404516
LinkDB All DBs
Position
Unknown
AA seq 539 aa AA seqDB search
MWRFSCALCLHTAKRSKSLGLWSRPAAFMSTLLINEPQYVWLKELGLREENEGVYNGSWG
GRGEVVTTYCPANNEPIARVRQASIADYEETVKKAREAWKIWADIPAPKRGEVVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVALMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNKLKKAYAQICVG
NPWDSNVLYGPLHTKQAVNMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLAHD
ASIVHTETFAPILYVFKFKNEDEVFAWNNEVKQGLSSSIFTRDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcttctcctgcgccctctgtctgcacactgcaaagaggagcaagtccttaggc
ctttggagcaggcctgccgccttcatgtccactctgctgatcaatgagccccagtatgtt
tggctgaaagagctggggctccgcgaggaaaacgagggcgtgtataatggaagctgggga
ggccggggagaggtggttacaacctattgtcctgctaacaatgagccaatagcaagagtc
cgacaggccagcatagcagactatgaagaaactgtaaagaaagcaagagaagcatggaaa
atatgggcggatattcctgctccaaagcgaggtgaagtagtaagacagattggtgatgcc
ttacgggagaagatccaagtgctaggaagcttggtgtctctggagatgggaaaaatctta
gtagaaggtgtgggagaagttcaagagtatgtggatatttgtgattatgctgttggctta
tcgcggatgattgggggacccatcttgccttctgaaagacctggccatgccctcattgag
cagtggaatcctgtaggcctggttgggatcatcactgctttcaacttccccgtggcagtg
tatggctggaacaatgccatcgcgatgatctgtgggaatgtctgcctttggaaaggcgct
ccaacaacttccctcattagtgtagctgtcacaaagataatagccaaagttctggaggac
aacaaactgcctggtgcaatttgttccctgacttgtggtggagcagacattggcacagca
atggccaaagatgagcgggtgaacctgctgtccttcactgggagcactcaggtgggaaaa
caagtggcccttatggtacaggagaggtttgggagaagtttgttagaacttggaggaaac
aatgccataattgcttttgaggatgcagacctcagcttagtcgttccatcagctctcttt
gcagccgtggggacagctggccagaggtgtacaactgcgaggcgactgtttttacatgaa
agcatccatgatgaagttgtaaataaacttaaaaaggcctacgcacagatctgtgtcggg
aacccatgggactctaatgttctctatgggccactccacacaaagcaggcagtgaacatg
ttccttggtgcggtggaagaagcaaagaaagaaggtggcacagtggtctatggtggcaag
gtcatggatcgtcctgggaactatgtagaaccgacgattgtgacaggccttgcccatgat
gcatccattgtgcacacagagacttttgctccaattctttatgtctttaaatttaagaat
gaagacgaggtctttgcatggaataatgaagtaaaacagggactttcaagtagtatattt
accagggatttgggaagaatcttccgctggcttggacctaaaggatcagactgtggcatc
gtcaacgtcaatattccaacgagtggggctgagatcggaggtgcatttggaggtgaaaaa
catactggtggtggcagggagtctggcagtgatgcctggaaacagtacatgagaagatct
acttgtaccatcaactacagcaaggaccttcctctggcccaaggaatcaagtttcagtaa

DBGET integrated database retrieval system