KEGG   Loxodonta africana (African savanna elephant): 100656286
Entry
100656286         CDS       T04351                                 

Gene name
TGFBR1
Definition
(RefSeq) TGF-beta receptor type-1 isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04060  Cytokine-cytokine receptor interaction
lav04068  FoxO signaling pathway
lav04144  Endocytosis
lav04218  Cellular senescence
lav04350  TGF-beta signaling pathway
lav04371  Apelin signaling pathway
lav04380  Osteoclast differentiation
lav04390  Hippo signaling pathway
lav04520  Adherens junction
lav04659  Th17 cell differentiation
lav04926  Relaxin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav05142  Chagas disease
lav05161  Hepatitis B
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05220  Chronic myeloid leukemia
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100656286 (TGFBR1)
   04350 TGF-beta signaling pathway
    100656286 (TGFBR1)
   04390 Hippo signaling pathway
    100656286 (TGFBR1)
   04371 Apelin signaling pathway
    100656286 (TGFBR1)
   04068 FoxO signaling pathway
    100656286 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100656286 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100656286 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    100656286 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100656286 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100656286 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100656286 (TGFBR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100656286 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100656286 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100656286 (TGFBR1)
   05212 Pancreatic cancer
    100656286 (TGFBR1)
   05225 Hepatocellular carcinoma
    100656286 (TGFBR1)
   05226 Gastric cancer
    100656286 (TGFBR1)
   05220 Chronic myeloid leukemia
    100656286 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100656286 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100656286 (TGFBR1)
   05161 Hepatitis B
    100656286 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100656286 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100656286 (TGFBR1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100656286 (TGFBR1)
Protein kinases [BR:lav01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100656286 (TGFBR1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Pkinase_fungal APH Activin_recp FTA2
Other DBs
NCBI-GeneID: 100656286
NCBI-ProteinID: XP_023400872
LinkDB
Position
Unknown
AA seq 434 aa
MCIAENDLIPRDRPFVCAPSSRTGSATTTYCCKQDHCNKIELPTPVKPTSGLGPVELAAV
IAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGS
GSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIY
QTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALST
ASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAP
NHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQLPYY
DLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIK
KTLSQLSQQEGIKM
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgtgtatagcggaaaacgacttaattcctcgagacaggccatttgtatgtgcgccctct
tcaagaactgggtctgcaactacaacatattgctgcaagcaggatcattgcaataaaata
gaactcccaactcctgtaaagccgacatccggccttggtcccgttgaactggcagctgtc
atcgctggaccagtgtgcttcgtctgcatctcgctcatgttgatggtctatatctgccat
aaccgcactgtcattcaccatcgagtgcccaacgaagaggatccttcattagatcgccct
tttatttcagagggtaccacattgaaagatttaatttatgatatgacaacatcaggttct
ggatcaggtttaccattgcttgttcagagaacaatcgcaagaactattgtattacaagaa
agcattggcaaaggtcgatttggagaagtttggcgaggaaagtggcggggagaagaagtc
gctgttaaaatattttcctctagagaagaacgctcatggtttcgcgaggcagagatttat
caaactgtaatgttacgtcatgaaaacatcctgggatttatagcagcagacaataaagac
aatggcacatggacccagctctggttggtctcagattatcatgagcatggatctcttttt
gattacttgaataggtacacagttaccgtggaaggaatgataaaactcgctctgtccaca
gcaagtgggcttgcgcatcttcacatggagattgttggtacccaaggaaaaccagccatt
gctcatagagatttgaaatcaaagaatatcttggtaaagaagaatggaacttgctgtatt
gcagacttgggactggcagtaagacacgattcagccactgatacaattgatattgctcca
aatcacagagtgggaacaaaaaggtacatggcccctgaagttctagatgattccataaat
atgaaacactttgaatccttcaaacgtgctgacatctatgcaatgggcttagtattctgg
gaaattgctcgacgatgttccattggtggaattcacgaagattaccagctgccttattat
gatcttgtaccttctgatccatcagttgaagaaatgagaaaagttgtttgtgaacagaag
ttaaggccaaatattccaaacagatggcaaagctgtgaagccttgagagtaatggctaaa
atcatgagagaatgttggtatgccaacggagcagccagacttacagctttgcggattaag
aaaacgttatcacaactcagtcaacaggaaggcatcaaaatgtaa

DBGET integrated database retrieval system