KEGG   Loxodonta africana (African savanna elephant): 100656333
Entry
100656333         CDS       T04351                                 

Gene name
MMP25
Definition
(RefSeq) matrix metalloproteinase-25
  KO
K08003  matrix metalloproteinase-25 (membrane-inserted) [EC:3.4.24.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100656333 (MMP25)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100656333 (MMP25)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     100656333 (MMP25)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M10
   100656333 (MMP25)
SSDB
Motif
Pfam: Hemopexin Peptidase_M10 PG_binding_1 Reprolysin_4 Astacin DUF4953 Peptidase_M66 Metallopep
Other DBs
NCBI-GeneID: 100656333
NCBI-ProteinID: XP_023413059
LinkDB
Position
Unknown
AA seq 548 aa
MLRHPLRPQLRLLALLVRLLPLLARGPEPAAQDLSLGVDWLTRYGYLPPPHPAQAQLQSP
AQLRDAIKVLQRFAGLPETGLMGRSLHPTALSALGLSTLVWALRKRLHFDNEEAWTFGSE
DGEGTDLFAVAVHEFGHSLGLAHSSAPDSIMRPFYQGPVGDPSKYRLSQDDRDGLQQLYG
KGPQTPHEEPTRKPLAPPPQPPALPPDSPSSPFPDRCEGNFDAIANIRGETFFFKGPWFW
RLQPSGQLVSPRPARLHRFWEGLPTQVRVIQAAYARHRDGRIVLFSGPQFWVFKDRQLEG
AARPLTELGLPPGEQVDAVFSWPLNGKTYLVRSQQYWRYDEAAGSPDPGYPRALSLWEGA
PSAPDDVTVSNTGGTYFFKGSYSWCFAKGSVVAHPDSLRPMGPCSRGGPPKAHSNSGASI
VSARSIRPRGPSLCPPAVPPVPAGGGRRLSKRCGFPCSGAPPSEPPPGAAQAQRTRSAAS
LDFQKLLTLSRPHHRPVQSPHIGDTYTFMGVLLALCQRQRLGGSGLIPFGPKRPECPVTV
VPRPKVSS
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgctacggcacccgctccgaccccagctccggctgctggcgctgctggtccggcttctg
ccgctgctcgcgcgcggcccggaacctgctgcacaggacctgagcctaggagtggactgg
ctgacccgctatggctacctgccgccgccccatcctgcccaggcccagcttcagagccct
gcgcagctgcgggatgcaatcaaggtcctgcagcgctttgctggattgcctgagaccggc
ctcatgggtaggtcgctccacccaactgccctctctgcactcggcctgagcaccttagtg
tgggcgttaagaaaacgcttacacttcgacaatgaggaggcctggacttttggctcagaa
gatggcgagggaacagacctctttgctgtggctgttcatgagtttggccactccctaggc
ctggcccactcctcagcacccgactccatcatgagacccttctaccagggcccagtgggc
gaccccagcaagtaccgcttgtcccaggatgaccgagatggtctgcagcagctctacggg
aaagggccccaaaccccacatgaggagcccacgaggaagcccctggctcctcctccccag
cctccggcactgcccccggacagcccctcatcccctttccctgaccgatgtgagggcaat
tttgacgccattgccaacatccgaggcgaaaccttcttcttcaaaggcccctggttctgg
cgcctccagccctcaggacaactggtatccccccggcctgcccggctgcaccgcttctgg
gaggggctgcctacccaggtgagggtcatccaggctgcctacgcccggcaccgagatggc
cgcatcgtcctcttcagcggcccccaattctgggtgttcaaggaccggcagctggagggc
gccgccaggcctctgacggagctagggctgcctccaggcgagcaggtggacgctgtgttc
tcctggccactgaacgggaagacctacctggtccgcagccagcagtactggaggtacgac
gaggcggctggcagcccagacccaggctacccacgcgccctaagtctctgggaaggggca
ccttccgctccagatgacgtcaccgtcagcaacacaggtggcacctacttcttcaagggc
tcctactcctggtgctttgccaagggcagcgtcgtggcccatccggactccctacgaccc
atggggccttgctccaggggtggcccccctaaagcgcactccaactctggagccagcatt
gtcagtgcaagatcaatcaggccacggggccccagcctctgccctcctgctgtccctcca
gtccctgctggtggggggcgtcgcctctccaaaaggtgcggcttcccctgctctggagcg
ccgccttcggagcctccgccaggggcggcccaggctcagcgaacgcggagcgctgcttct
ctggacttccagaagcttctcaccctgtcccgcccccaccaccgcccagtgcaatcaccc
cacattggtgacacctacaccttcatgggcgtactcctggcgctttgccaaaggcagcgt
cttggcggatccggactcattccctttgggccgaagaggccggagtgcccggtcacagtg
gtgccccgccccaaagtgtcctcctag

KEGG   Loxodonta africana (African savanna elephant): 100662936
Entry
100662936         CDS       T04351                                 

Gene name
MMP16
Definition
(RefSeq) matrix metalloproteinase-16
  KO
K07996  matrix metalloproteinase-16 (membrane-inserted) [EC:3.4.24.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100662936 (MMP16)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100662936 (MMP16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100662936 (MMP16)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     100662936 (MMP16)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M10
   100662936 (MMP16)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M66 Peptidase_M54 Metallopep Reprolysin_3 DUF4953
Other DBs
NCBI-GeneID: 100662936
NCBI-ProteinID: XP_003408426
UniProt: G3T4E2
LinkDB
Position
Unknown
AA seq 607 aa
MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGSEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
ALTGQKWQHRHITYSIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ
PGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVW
KGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRDK
EGHSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCK
RSMQEWV
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgatcttactcacattcagcactggaagacggttggatttcgtgcatcactcgggggta
tttttcttgcaaaccttgctttggattttatgtgctacagtctgcggatcggagcagtat
ttcaatgtggaggtttggttacaaaaatacggctacctgccaccgactgaccccagaatg
tcggtgctgcgctctgcggagaccatgcagtccgccctagctgccatgcagcagttctat
ggcattaacatgacaggaaaagtggacagaaacacaattgactggatgaagaagcctcgc
tgtggtgtacctgaccagacaagaggtagctccaaatttaatatccgtcggaagcgatat
gcattaacaggacagaagtggcagcacagacacatcacctacagtataaagaacgtaact
ccaaaagtaggtgaccctgagacccgtaaagctattcgccgtgcctttgatgtgtggcag
aatgtaactcctctgacatttgaagaagttccctacagtgaattagaaaatggcaaacgt
gatgtggatataaccatcatttttgcatctggttttcatggagacagttctccctttgat
ggagagggaggatttttggcacatgcctattttcctggaccaggaattgggggagatact
cattttgattcagatgagccatggactctaggaaatccgaatcatgatggaaatgactta
tttcttgtagcagttcatgaactgggacatgctctgggattggagcattccaatgacccc
acagccatcatggctccattttaccagtacatggaaactgacaacttcaaactacctaat
gatgatttgcagggcattcagaagatatacggtccacctgacaagattcctccacctaca
agacctctaccaacagtgcccccgcaccgctctattcccccggctgacccgaggaagaac
gaccggccaaaacctccgaggcctcctaccggcagaccttcctatcctggagccaaaccc
aacatctgtgatgggaactttaacactctagctattcttcgccgtgagatgtttgttttc
aaggaccagtggttctggcgagtgagaaacaacagggtgatggatggataccccatgcaa
attacttacttctggagggggctgcctcctagtattgacgcagtttatgaaaacagtgac
gggaattttgttttctttaaaggtaacaaatactgggtgttcaaggatactacccttcaa
cctggttaccctcatgacttgattactcttggaagtggaattccccctcacggtattgat
tcagccatttggtgggaggatgttggcaaaacctatttcttcaagggagacagatattgg
agatacagtgaagaaatgaaaaccatggatcccggctatcccaagccaatcacagtctgg
aaaggcattcctgaatctcctcagggagcctttgtccacaaagaaaatggctttacatat
ttctacaaaggaaaggagtattggaaattcaacaaccaaatactcaaggtagaacctgga
tatcccagatccatccttaaggattttatgggctgtgatgggccaacagacagagataaa
gaaggacacagcccaccagatgatgtagacattgtcatcaaactggacaacacagccagc
actgtgaaagccatagctattgtcattccctgcatcttggccttatgcctccttgtattg
gtttacactgtgttccagttcaagaggaaaggaacaccccgccacatactgtactgcaaa
cgctctatgcaagagtgggtgtga

KEGG   Loxodonta africana (African savanna elephant): 100667595
Entry
100667595         CDS       T04351                                 

Gene name
MMP24
Definition
(RefSeq) matrix metalloproteinase-24
  KO
K08002  matrix metalloproteinase-24 (membrane-inserted) [EC:3.4.24.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100667595 (MMP24)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100667595 (MMP24)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     100667595 (MMP24)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M10
   100667595 (MMP24)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M66 Metallopep DUF4953 Peptidase_M54 Reprolysin_3 Reprolysin_4
Other DBs
NCBI-GeneID: 100667595
NCBI-ProteinID: XP_003411565
LinkDB
Position
Unknown
AA seq 573 aa
MHPFLSHVFQSWLKSYGYLLPYDSRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIE
WMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAF
DVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGI
GGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNF
KLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPST
PGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAA
YERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFK
GERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKL
SVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDADIMVTINDVPGSVNAVAVVIPCILS
LCILVLIYTIFQFKNKAGPQPVTYYKRPVQEWV
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgcatccttttctctcacatgtctttcagagctggttaaagtcatatggctatctactt
ccctatgattcacgggcatctgcgttgcactcaggcaaggccttacagtcagcagtctcc
actatgcagcagttttacggcatcccagtcaccggtgtgttggatcagacaacaatcgag
tggatgaagaaacctcgatgtggtgtccctgatcacccccacttgagccgcaggcgaaga
aacaagcgctacgccctgactggacagaagtggaggcaaaagcacatcacctacagcatt
cacaactacaccccaaaagtgggtgagctggacacacggaaagctattcgccaggctttt
gatgtgtggcagaaggtcaccccgctgacctttgaagaggtgccgtaccatgagatcaaa
agtgatcggaaggaggcagacatcatgatcttttttgcttctggtttccatggcgacagc
tccccatttgatggggaagggggattcctggcccatgcctacttccctgggccagggatt
ggaggagacactcactttgactcagacgagccatggacactaggaaatgccaaccatgat
ggcaatgacctcttcctggtggctgtgcatgagttgggccacgcactgggcctggagcac
tccaatgatcccagcgctatcatggcacccttctaccagtacatggagacacacaacttc
aagctgccccaggatgatctccagggcatccagaagatctatggacccccagctgagcct
ctggagcccaccaggcccctccccacgctccctgtccgcaggatccactcaccgtctgag
aggaagcatgaacgccagcccaggccccctcggccacccctcggggaccggccatccaca
ccgggagccaaacccaacatctgtgatggcaacttcaatacagtggccctctttcggggc
gagatgtttgtgtttaaggatcgctggttctggcgcctgcgcaacaaccgggtgcaggaa
ggctaccccatgcagatcgagcagttttggaagggcctgcctgcccgcatagatgcagcc
tacgaaagggctgatggcagatttgtcttcttcaaaggtgacaagtactgggtgtttaag
gaagtgacggtggaacctgggtatcctcacagcctaggggagctgggcagctgtctgccc
cgggaaggcattgacacagctttgcgctgggaacccgtgggcaagacgtacttcttcaaa
ggcgagcggtactggcgctacagcgaggagcggcgggccacagaccctggctaccccaag
cccatcaccgtgtggaagggcatcccacaggcgccccaaggggctttcatcagcaaagaa
ggatattacacctacttctacaagggccgggactactggaagtttgacaaccaaaaactg
agcgtggagccaggttacccacgcaacatcctgcgtgactggatgggctgcaaccagaag
gaggtagagcggcgcaaggagcggcggctgccccaggatgatgcggacatcatggtgacg
atcaatgatgtgccaggctctgtgaatgccgtggccgtggtcatcccctgcatcctgtcc
ctctgcatcctggtgctgatctacaccatcttccagttcaagaacaaggcaggccctcag
cctgtcacctactataagcgaccagtccaggagtgggtgtga

KEGG   Loxodonta africana (African savanna elephant): 100671131
Entry
100671131         CDS       T04351                                 

Gene name
MMP14
Definition
(RefSeq) matrix metalloproteinase-14
  KO
K07763  matrix metalloproteinase-14 (membrane-inserted) [EC:3.4.24.80]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04668  TNF signaling pathway
lav04912  GnRH signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100671131 (MMP14)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100671131 (MMP14)
   04928 Parathyroid hormone synthesis, secretion and action
    100671131 (MMP14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100671131 (MMP14)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.80  membrane-type matrix metalloproteinase-1
     100671131 (MMP14)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M10
   100671131 (MMP14)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M54 DUF4953 Metallopep HTH_17 Peptidase_M66 Reprolysin_3 Reprolysin_5 SKG6
Other DBs
NCBI-GeneID: 100671131
NCBI-ProteinID: XP_010598801
UniProt: G3SQ16
LinkDB
Position
Unknown
AA seq 583 aa
MSPAPRPARRLLLPLLTLGTVLASLDLAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLRVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLHFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSQSGSPTKIPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAVLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSSGGRPDQGTEEETEVIIIEVDEEGSGAVSA
AAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgtctcccgccccacgacccgctcgcaggctgctgcttcccctgctcacgctcggcacg
gtgctcgcctccctcgacttggcccaaagcagcagcttcagccccgaagcctggctacag
cagtatggctacctgccccctggggacctgcgtactcacacacagcgctcacctcagtca
ctctcagctgccatcgctgccatgcagaagttctatggtttgcgagtgacaggcaaagct
gatgcagacaccatgaaggccatgaggcgtccccgctgtggtgttccagacaagtttggg
gctgagatcaaggccaatgttcgaaggaagcgctatgccatccagggcctcaaatggcaa
cataatgagattactttctgcatccagaattacacccccaaggtgggcgagtatgccaca
ttcgaggccattcgcaaggcattccgcgtatgggagagtgccacacctctgcacttccgt
gaggtgccctatgcctacatccgtgagggccatgagaagcaggccgacatcatgatcttc
tttgccgagggcttccatggcgacagcacgcccttcgatggcgagggcggcttcctggcc
cacgcctacttcccaggccccaacattggaggggacactcactttgactctgctgagccc
tggactgtccggaatgaggatcttaatgggaatgacatcttcctggtggctgtgcatgag
ctgggccatgccctgggcctcgagcattccaatgacccctcagccatcatggcacccttt
taccagtggatggacacagagaactttgtgctgcctgacgatgaccgccggggcatccag
caactttatgggagtcagtcagggtcccccaccaagatcccccctcaacccaggacaacc
tcccggccctctgtccctgataagcccaaaaaccccacctatgggcccaacatctgtgac
gggaacttcgacactgtggccgtgctccgaggggagatgtttgtcttcaaggagcgttgg
ttttggcgggtgaggaataaccaagtgatggatggttacccaatgcccatcggccagttc
tggcggggcttgcctgcatctatcaacactgcctacgagaggaaggatggcaagtttgtc
ttcttcaaaggagacaagcattgggtgtttgatgaggcatccctggaacctggctacccc
aagcacattaaggagctgggccgtggactgcctactgacaagattgatgctgccctcttt
tggatgcccaacgggaagacctacttcttccggggaaacaagtactaccgtttcaatgag
gagctcagggcagtggacagcgagtaccccaaaaacatcaaagtctgggaaggaatccct
gagtcacccagagggtcattcatgggcagcgacgaagtcttcacttatttctacaagggg
aacaaatactggaaattcaacaaccagaagctaaaggtggagccaggctaccccaagtca
gccctgcgggactggatgggctgcccatcgtctgggggccggccagatcaggggactgag
gaggagacggaggtgatcatcatcgaggtggacgaggagggcagtggggcagtgagcgca
gccgctgtggtgctgcctgtgctgctgctgcttctggtgctggcagtgggcctcgctgtc
ttcttcttcagacgccatgggactcccaagcgactgctctattgccagcgctccctgctg
gacaaagtctga

KEGG   Loxodonta africana (African savanna elephant): 100674357
Entry
100674357         CDS       T04351                                 

Gene name
MMP15
Definition
(RefSeq) matrix metalloproteinase-15
  KO
K07995  matrix metalloproteinase-15 (membrane-inserted) [EC:3.4.24.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100674357 (MMP15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100674357 (MMP15)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     100674357 (MMP15)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M10
   100674357 (MMP15)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Reprolysin_3 Peptidase_M54 Astacin Metallopep DUF4953 Peptidase_M66 Reprolysin_5
Other DBs
NCBI-GeneID: 100674357
NCBI-ProteinID: XP_003416326
LinkDB
Position
Unknown
AA seq 671 aa
MGSNRRAPGQPDWAGSLLRVWEVAAQTPLLPLLLVLLGCLGRGAVAEDAEVDAEKWLRLY
GYLPQPSSYMSTLRSAQILASALAEMQRFYGIPVTGVLDEETKAWMKRPRCGVPDQFGLH
VKANLRRRRKRYALTGKKWNTYHLTFSIQNYTPKLGWYHSLEALRRAFHVWEQATPLVFE
EVPYEDIRRQRQKEADIMVLFASGFHGDSSPFDGTGGFLAHAYFPGPGMGGDTHFDADEP
WTLSNTDVNGNNLFLVAVHELGHALGLEHSNNPTAIMAPFYQWMDTDNFQLPEDDLRAIQ
RLYGTPDGQPRPTQLLLTVTPRRLGRPDHRPPRPPPPGRKPEQPPKPAPPARPRAPARPG
QYGPNICDGNFDTVAVLRGEMFVFKGLWFWRVRHNHVLDNYPMPIGHFWRGLPGNISAAY
ERQDGRFVFFKGNRYWLFREVNLEPGYPQPLTSYGLGIPYDHIDTAIWWEPTGHTFFFQE
DRYWRFNEETQHGDPGYPKPISVWQGIPASPKGAFLSNDGAYTYFYKGTKYWKFDNQRLR
MEPGYPKSILRDFMGCYEHVEPEPGPRWPHVDHPPFIPDGDGDTMPSAGDSQEEAGPASE
EDFEAGEDQDGGSRVVVQMDEAARTVNVVEVLVPLVLLLCLLGLTYALVQLQRKGAPRML
LYCKRSLQEWV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgggcagcaaccggcgtgctcccgggcagccggactgggcgggcagcctcctccgtgtc
tgggaggtggcggcgcagacgccactgctgccgctgctgctggtgcttctgggctgcctg
ggccgcggcgcagtggcggaggacgcagaagtcgacgccgagaagtggctgcggctctat
ggctacctaccgcagcccagcagctacatgtccaccctgcgctccgcccagatcctggct
tcagcccttgccgagatgcagcgcttctatgggattccggtcaccggtgtgcttgatgaa
gagaccaaggcgtggatgaagcggccccgctgtggggtgccagaccagtttgggttgcat
gtgaaggccaacctgcggcggcggcggaagcgctatgctctcactgggaagaagtggaat
acataccacttgaccttcagcatccagaactacacacccaagctgggctggtaccactca
ctggaggcgttgcgcagggccttccatgtgtgggagcaggccacaccgctggtcttcgag
gaggtgccctatgaggacatccggcggcagcggcagaaggaggctgatatcatggtactc
tttgcctccggcttccatggcgacagctcaccatttgacggcacgggtggctttctggcc
cacgcctatttccccggccccggcatgggcggagatacccatttcgatgcagatgaaccc
tggaccttatccaacactgatgtgaatggaaacaacctcttcctggtggcggtgcatgag
ctgggccatgcgctggggctggagcattcgaacaatcccaccgccatcatggcgcccttc
taccagtggatggacacagacaacttccagctacccgaggacgacctccgggccatccag
cggctctatggcaccccagatggtcagccacggcccacacagctcctcctcactgtgaca
ccacggcggctaggccggccagaccaccgccctcctcggcccccacccccaggcaggaag
ccagaacagcccccaaagccggctccccctgcccggccccgagccccggcgcggcctggc
cagtatggccctaacatctgcgatgggaactttgacacagtggccgtgctgcgtggggag
atgttcgtgttcaagggcctctggttctggcgggtccggcacaaccacgtcctggacaac
tatcccatgcctatcgggcacttctggcgtggcctgcccggtaacatcagtgctgcctat
gagcgccaggatgggcgttttgtcttcttcaagggtaaccgctactggctcttccgagaa
gtgaacctggagcccggctacccccagccactaaccagctatggcctggggatcccctac
gaccacattgacacggccatctggtgggagcccacaggccacaccttctttttccaagag
gacaggtactggcgcttcaatgaggagacgcagcatggagaccctggctaccccaagccc
atcagtgtctggcaggggatccctgcctccccgaaaggggccttcctgagcaatgacgga
gcctacacctacttctacaaaggcactaaatactggaagttcgacaaccagcgcctgcgc
atggagcccggttacccgaagtccatcctgcgggacttcatgggctgctacgagcacgtg
gagcccgagcccgggccccgatggccccacgtggaccacccgcccttcatccctgacgga
gacggagacacgatgccgagtgcaggtgacagccaggaggaggcggggcctgccagcgag
gaggacttcgaggccggggaggaccaggatgggggcagccgcgtggtggtgcagatggac
gaggcagcgcggacggtgaacgtggtggaggtgttggtcccgctggtgctgctgctgtgc
ctcctgggcctcacctacgcgctggtgcagctgcagcgcaagggtgcaccgcgcatgctc
ctctactgcaagcgctccctgcaggagtgggtctga

KEGG   Loxodonta africana (African savanna elephant): 100676839
Entry
100676839         CDS       T04351                                 

Gene name
MMP17
Definition
(RefSeq) LOW QUALITY PROTEIN: matrix metalloproteinase-17
  KO
K07997  matrix metalloproteinase-17 (membrane-inserted) [EC:3.4.24.-]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100676839 (MMP17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100676839 (MMP17)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     100676839 (MMP17)
Peptidases and inhibitors [BR:lav01002]
 Metallo peptidases
  Family M10
   100676839 (MMP17)
SSDB
Motif
Pfam: Hemopexin Peptidase_M10 PG_binding_1 Peptidase_M66
Other DBs
NCBI-GeneID: 100676839
NCBI-ProteinID: XP_023396198
LinkDB
Position
Unknown
AA seq 605 aa
MLLLLLLALEARGGCAAPAPRAEDLSLGVEWLSRFGYLPRSDPTTGQLQTQEELSKAITA
MQQFGGLEATGVLDEATLALMKTPRCSLPDLPATAAVRQRRQAPTPTKWNKRNLSWRVRC
DVPSDSALGRDTVRXLMYYALKFWSDIAPLNFHEXAGSAADIQIDFSRADHDDGYPLSTF
PAHRAHAFLPCDHXSRGDAHFDDDDSHCPRPPDAHGMDLFAVAVHEFGHAIGLSHVGAAQ
SIMRPYYQGPVGDPLRYGLPYEDRVRVWQLYGVRESVSPTGPPEPDSPPPLPDPPDNRSS
APHHPQLPCPVPAPSPPHPQPTLHRPPASPPRPQDAPPRPPGSLPAFFFKGKYFWRLTRD
RHLVSLRPAQVHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRP
ISDFSLPPGGVDAAFSWAHNDKTYFFKDQLHWRYDDHTRRMDPGYPAQSPPWRGVPSPLD
DAMRWSDGASYFFRGKDYWKVLDSDLEVAPGYPQSTARDWLVCGDLQAGHHDGAGSDHED
RAQAQPGQHDQSRSEGGYEVCSCTSLASPLPRAPGTLVVTMLLLLLLLLPPPPNLPWTAA
QAQGL
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgctgctgctgctgctgctcgcgttggaggctcgcgggggttgcgctgcgcccgcgccc
cgcgcggaggacctcagcctgggagtggagtggctgagcaggtttggctatctgccccgc
tcagaccccaccactgggcagctacagacccaagaggagctgtcgaaggccatcaccgcc
atgcagcagttcgggggcctagaggccactggcgtgctggacgaggccaccctggcgctg
atgaagactccgcgctgctctctccccgacctccctgccacagccgctgttcgacagagg
cgccaggctcccaccccgaccaagtggaacaagaggaacctgtcctggagggttaggtgc
gacgttccctcggactcggccctgggtcgcgacacggtgcggncgctcatgtactacgcc
ctcaagttctggagcgacatcgcgccgctcaacttccacgagngtgccggcagtgcggcc
gacatccagatcgacttctccagggccgaccacgacgacggttaccctctttcgacgttc
ccggcgcaccgtgcccacgccttccttccctgcgaccacnncagccgcggggacgcccac
ttcgacgacgacgactcacactgcccgcgtcccccagatgcccacgggatggacctcttc
gcagtagccgtccacgagttcggccatgccattgggctgagtcacgtcggtgccgcccag
tccatcatgcggccgtactaccagggcccagtgggcgacccgctgcgctacgggctgccc
tatgaggaccgagtgcgcgtctggcagctgtacggtgtgagggaatctgtgtcccccacc
ggacccccagagcccgattcaccgcctcccctgccagacccacctgacaaccggtctagt
gccccccaccacccccagctgccctgcccggtccctgccccttctccgccccacccccag
cccacactgcaccgcccacccgcctctccaccccgcccccaggatgcaccaccacgccca
cctggctctctgcctgccttcttcttcaaaggcaagtacttctggcggctgacccgggac
cggcacctggtgtcgctgcggccggcgcaggtgcaccgcttctggcgggggctgccgctg
cacctggacagcgtggacgccgtatacgagcgcaccagcgaccacaagatcgtcttcttc
aaaggagacagatactgggtgtttaaggacaataacgtagaggaaggatacccacggccc
atctccgacttcagccttccgccgggcggcgtggatgccgccttctcctgggcccacaat
gacaagacttatttctttaaggaccaactgcactggcgctatgatgaccacacgcggcgc
atggatcccggctaccctgcccagagccccccgtggaggggcgtcccgagcccgcttgac
gatgccatgcgctggtctgacggtgcctcctacttcttccgtggcaaggactactggaag
gtgctggacagcgacctggaggtggcgcctgggtacccgcagtccacggcccgagactgg
ctggtctgtggggacttgcaggccgggcaccacgacggtgctggctcggaccatgaggac
agggctcaggcccagccgggccagcacgaccagagccgctctgagggtggatacgaggtc
tgctcctgcacctccctggcctccccgctccccagggccccaggcacgctggtggtcacc
atgctgctgcttctcctgctgctgctgcctccaccgccaaacttaccgtggacagcggcc
caggcccaaggactatga

DBGET integrated database retrieval system