KEGG   Loxodonta africana (African savanna elephant): 100656361
Entry
100656361         CDS       T04351                                 

Gene name
HSP90AB1
Definition
(RefSeq) heat shock protein HSP 90-beta
  KO
K04079  molecular chaperone HtpG
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04141  Protein processing in endoplasmic reticulum
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04612  Antigen processing and presentation
lav04621  NOD-like receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04659  Th17 cell differentiation
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav05132  Salmonella infection
lav05200  Pathways in cancer
lav05215  Prostate cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100656361 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100656361 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100656361 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100656361 (HSP90AB1)
   04612 Antigen processing and presentation
    100656361 (HSP90AB1)
   04659 Th17 cell differentiation
    100656361 (HSP90AB1)
   04657 IL-17 signaling pathway
    100656361 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100656361 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    100656361 (HSP90AB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100656361 (HSP90AB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100656361 (HSP90AB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100656361 (HSP90AB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100656361 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100656361 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lav03110]
    100656361 (HSP90AB1)
   04131 Membrane trafficking [BR:lav04131]
    100656361 (HSP90AB1)
   03051 Proteasome [BR:lav03051]
    100656361 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100656361 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100656361 (HSP90AB1)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100656361 (HSP90AB1)
Chaperones and folding catalysts [BR:lav03110]
 Heat shock proteins
  HSP90
   100656361 (HSP90AB1)
Membrane trafficking [BR:lav04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100656361 (HSP90AB1)
Proteasome [BR:lav03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100656361 (HSP90AB1)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100656361 (HSP90AB1)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100656361 (HSP90AB1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 100656361
NCBI-ProteinID: XP_003403940
UniProt: G3TVD7
LinkDB
Position
Unknown
AA seq 723 aa
MPEEVHHGDEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
KDDEEKPKIEDVGSDEEDDSSKDKKKKTKKIKEKYIDREELNKTKPIWTRNPDDITQEEY
GEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVF
IMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAE
DKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK
SIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGL
ELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTAN
MERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFET
ALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRME
EVD
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgcctgaggaggtgcaccatggagacgaggaggtggagacctttgctttccaggcagag
attgcccagctcatgtctctcatcatcaatactttttattccaacaaggaaattttcctt
cgggagttgatttctaatgcttctgatgccttggacaagattcgttatgagagtctgact
gacccttctaagttagacagtggtaaagagttgaaaatcgacatcatccccaacccccaa
gaacgcactctgacgctggtggacacaggcattggcatgaccaaggctgatctcataaat
aatttgggaaccattgccaagtctgggaccaaagcatttatggaggctctgcaggctggt
gcagacatctccatgattgggcagtttggtgttggattttattctgcctatttggtggca
gagaaagtggttgtgattacgaaacacaatgatgatgagcagtatgcttgggagtcttct
gctgggggttctttcactgttcgcgctgaccacggtgagcccattggtcggggtacgaaa
gtgattctgcaccttaaagaagaccagacagagtacttagaagagaggcgagtcaaagaa
gtagtgaagaaacactcccagttcataggctaccccatcaccctttatttggagaaggaa
agagagaaggaaatcagtgacgacgaggcagaggaagagaaaggtgagaaagaagaagaa
aaggacgatgaagagaagccaaagattgaagacgtgggctcagatgaggaggatgatagc
agtaaggacaagaaaaagaaaaccaagaagatcaaggagaagtacattgatcgggaagaa
ctgaacaagaccaagcccatttggaccagaaatcctgatgacatcacccaggaggaatac
ggagaattctacaagagccttactaatgattgggaagaccacttggcagtcaagcatttc
tctgtagaaggtcaactggaattcagggcattgctgtttatcccccgccgggctcccttt
gatctctttgagaacaagaagaaaaagaacaacattaagctttatgtgcgtcgtgtgttc
atcatggacagctgtgatgagttgataccagagtatctcaacttcatccgtggtgtggtt
gactctgaggacctgcctctcaacatctcccgagaaatgctccagcagagcaaaatcttg
aaggtcatccgcaaaaacattgtcaagaagtgccttgagctcttctctgagttggcagaa
gacaaggagaactataagaaattctatgaggcattttctaaaaacctgaagcttggaatc
catgaggactctactaaccggcgacgcctttctgagctgctgcgctatcacacctcccaa
tctggagatgagatgacttctctctcagaatatgtttctcgcatgaaggagacccagaag
tccatctattacatcactggtgagagcaaagagcaggtggccaactctgcttttgtggag
cgagtaaggaagcggggctttgaagttgtgtatatgactgagcctattgacgagtactgt
gtgcagcagctcaaggagtttgatgggaagagcttggtctcagttaccaaggagggccta
gagctaccagaggatgaagaggagaagaagaaaatggaggagagcaaggccaagtttgag
aatctctgcaagctcatgaaagagattttggataagaaggttgagaaggtgaccatctcc
aatagacttgtgtcttcaccctgctgcattgtgactagcacatacggctggacggctaac
atggagcggatcatgaaagcccaggcacttcgggacaactctacaatgggctacatgatg
gccaaaaagcacctggagatcaaccctgaccaccccatcgtggagacgctgcggcagaag
gctgaggcagacaagaacgacaaggctgtcaaggacctggtggtgctgctgtttgaaact
gctctgctctcttccggcttctctcttgaggatccccagacccactccaaccgcatctac
cgcatgatcaagctgggcttaggcattgatgaagatgaagtgacagctgaggaacccagt
gctgctgttcctgacgagatcccccctcttgagggcgatgaggatgcatcgcgtatggaa
gaagtagattag

KEGG   Loxodonta africana (African savanna elephant): 100676217
Entry
100676217         CDS       T04351                                 

Gene name
HSP90AA1
Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock protein HSP 90-alpha
  KO
K04079  molecular chaperone HtpG
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04141  Protein processing in endoplasmic reticulum
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04612  Antigen processing and presentation
lav04621  NOD-like receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04659  Th17 cell differentiation
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav05132  Salmonella infection
lav05200  Pathways in cancer
lav05215  Prostate cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100676217 (HSP90AA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100676217 (HSP90AA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100676217 (HSP90AA1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100676217 (HSP90AA1)
   04612 Antigen processing and presentation
    100676217 (HSP90AA1)
   04659 Th17 cell differentiation
    100676217 (HSP90AA1)
   04657 IL-17 signaling pathway
    100676217 (HSP90AA1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100676217 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    100676217 (HSP90AA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100676217 (HSP90AA1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100676217 (HSP90AA1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100676217 (HSP90AA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100676217 (HSP90AA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100676217 (HSP90AA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lav03110]
    100676217 (HSP90AA1)
   04131 Membrane trafficking [BR:lav04131]
    100676217 (HSP90AA1)
   03051 Proteasome [BR:lav03051]
    100676217 (HSP90AA1)
   03029 Mitochondrial biogenesis [BR:lav03029]
    100676217 (HSP90AA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100676217 (HSP90AA1)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100676217 (HSP90AA1)
Chaperones and folding catalysts [BR:lav03110]
 Heat shock proteins
  HSP90
   100676217 (HSP90AA1)
Membrane trafficking [BR:lav04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100676217 (HSP90AA1)
Proteasome [BR:lav03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100676217 (HSP90AA1)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100676217 (HSP90AA1)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100676217 (HSP90AA1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 LOH1CR12 BPS1 Zip DUF5759
Other DBs
NCBI-GeneID: 100676217
NCBI-ProteinID: XP_010587137
LinkDB
Position
Unknown
AA seq 738 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPI
GRGTKVILHLKEDQTEYLEERRMKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEE
KEEEKEKEEKESDDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEVLNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRSVXPAPFDLFENR
KKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKN
LVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMV
SLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKE
FEGKTLVSVTKEGLELPEDEDEKKKQEEKKTKFENLCKIMKDILEKKVEKVRGVSNRLVT
SPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADK
NDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVAE
EMPPLEGDDDTSRMEEVD
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgcccgaggagacccagacccaagaccagcccatggaggaggaggaggtggagacgttc
gccttccaggccgagatcgctcagttgatgtccttgatcatcaatacattctactccaac
aaagaaatctttctgagggagctgatttcaaattcatcagatgctctggacaaaattaga
tacgaaagcttgacggatcccagtaagctggattctgggaaagagctacatattaatctc
attcccaacaagcaagaccgaaccctcacgattgtggacactggaattgggatgaccaag
gccgacttgatcaataatcttggtaccatcgccaagtcgggtaccaaagcgttcatggaa
gctttgcaggctggtgcagacatctccatgattggccagttcggtgtggggttttattct
gcatatttggttgctgagaaagtgaccgtgatcaccaaacataatgatgatgaacagtat
gcatgggagtcttcggcaggagggtctttcacagtgaggacagacacaggtgaacccatc
ggccgtggaaccaaggttattctgcatctgaaagaagaccagaccgagtacttggaggag
agaagaatgaaggagatagtgaagaaacattcccagtttattggttatccgatcactctc
tttgtggagaaagaacgagataaagaagtgagtgatgatgaggctgaagaaaaggaagag
aaagaggaagagaaagaaaaagaagaaaaggagtccgatgataagcctgaaatagaagat
gttggttctgatgaagaggaagaagagaaaaaggatggtgacaagaagaagaaaaagaag
ataaaggaaaagtacatcgaccaagaggtactcaacaaaacaaagcccatttggaccaga
aatcctgatgatattaccaatgaagaatatggagaattttataagagcttgaccaatgac
tgggaagatcacttggctgtgaagcatttctcagttgaaggacagctagaattcagagcc
cttctctttgtcccaagacgttccgtttgacctgctccgtttgacctgtttgaaaacaga
aagaaaaagaacaatattaaattgtatgtacgcagagttttcatcatggataactgtgag
gagctaattcctgagtacctgaatttcattagaggcgtggtggactctgaggatctccct
ctaaatatttcccgtgagatgttgcaacaaagcaaaattttgaaagttatcaggaagaac
ttggtcaaaaagtgcttagaactcttcactgaactggcagaagataaagagaactacaaa
aagttttacgagcagttctctaaaaacattaagctcgggatacacgaagactctcaaaat
cggaagaagctctctgagctgttaagatactacacatcggcttcaggtgatgagatggtt
tccctcaaggactactgcacccgaatgaaggagaaccagaaacacatttactacatcacc
ggtgaaaccaaggaccaagttgctaactcggcctttgtggaacggctccggaagcatggc
ttagaggtgatctatatgatcgagcccatcgatgagtactgtgtccaacagctgaaggaa
tttgaggggaagaccttagtgtcagtcaccaaagagggtctggaacttccagaagacgaa
gacgagaaaaagaaacaagaggagaaaaaaacaaagtttgaaaacctctgcaaaatcatg
aaagacattttggagaaaaaagttgaaaaggtacgtggtgtgtcaaaccgattggtcacg
tccccatgctgtattgtcaccagcacgtacggctggacggcaaatatggaaagaatcatg
aaggctcaggccctaagagacaactcgacaatgggctacatggcagcaaagaagcacctg
gagataaatccggatcattccatcattgagaccttgcggcagaaagctgaggccgacaag
aacgataagtctgtgaaggatctggtcatcttgctctatgagaccgccctcctgtcctct
ggctttagtctagaggacccccagacacacgctaacaggatctacaggatgatcaagctt
ggtctgggtattgatgaagatgaccctactgctgacgataccagtgctgctgtcgctgaa
gaaatgccgcccctcgaaggagacgacgacacgtcgcgcatggaagaagttgactga

DBGET integrated database retrieval system