KEGG   Loxodonta africana (African savanna elephant): 100656367
Entry
100656367         CDS       T04351                                 

Gene name
NOTCH4
Definition
(RefSeq) LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 4
  KO
K20996  Notch 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04330  Notch signaling pathway
lav04919  Thyroid hormone signaling pathway
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100656367 (NOTCH4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100656367 (NOTCH4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100656367 (NOTCH4)
   05206 MicroRNAs in cancer
    100656367 (NOTCH4)
  09162 Cancer: specific types
   05224 Breast cancer
    100656367 (NOTCH4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100656367 (NOTCH4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100656367 (NOTCH4)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Notch Ank_2 Ank Ank_5 Ank_3 Ank_4 EGF_2 NODP NOD EGF_3 cEGF
Other DBs
NCBI-GeneID: 100656367
NCBI-ProteinID: XP_023397167
LinkDB
Position
Unknown
AA seq 2061 aa
MQPPSLLLLLLLLPPCFSINKTRGLRCESFLEACANGGTCLTLSPGQEACQCAPGFFGET
CQFPDPCQDAQLCQNGGSCQVQLPAPPVSPSPPSPLAPSFFCTCPPGFLGEMCQARLGDP
CFPSFCQKRGRCHIQASGHPRCHCMSGWTGEWCQLRDFCSAKPCANRGVCLATHPQIQCD
CPPGFTGYACEHDINECFLDAGPCPKGTSCHNTLGSFQCLCSAAHEGPPCGLQAGPCPPS
GCLNGGTCQLVPGGDSTFHLCLCPPGFTGPECEVNPDDCIGHECQNGGTCQDGLSNYTCL
CPETWTGWDCSEDVDECEAQGPPHCKNGGTCQNSPGSFHCVCVSGWGGTGCEENLDDCVT
ATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHREAQCSTNPLKGSTLCLCQ
PGYSGPTCHQDLDECEMAQQGPSPCEHGGSCHNTPGSFDCVCTPGYTGSRCEADHNECLS
QPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETDECASAPCLNHADCHDLRNGFLCVCQP
GFTGTRCEEDIDECGSSPCANGGQCQDQPGAFRCKCLPGFEGPRCETEVDECLSGPCPTG
ASCLDLPGAFSCLCPSGLTGQFCEAPLCAPNLCQHKQECQDQEDKAHCLCPDGSPGCAPT
EDNCTCHHGHCQRSLCVCDMGWTGPECEAELGGCISMPCAHGGTCSPQPSGYNCTCPGGY
TGPTCSEEVTACHSGPCLNGGSCNPSPGGYSCTCPPSHTGLRCQTNTDHCASAPCLNGGT
CVNRPGTASCLCAMGFQGPRCEERIRPSCTDSPCRNRATCQDGPQGPRCLCPAGYTGDSC
QALVDLCAQKPCPHNARCLQTGPAFQCLCLQGWTGPLCDLQLSSCQRAALSQGTDVSSLC
HNGGLCIDSGPSYFCHCPPGFQGSLCQDRVSPCESRPCQHGATCVAQPNGYLCQCTPGYS
GQNCSEEPDACQSQPCYNHGTCTPKPGGFHCSCPPGFVGLRCEGDVDECLDRPCHPRGTA
ACHPLANAFYCQCLPGHTGQWCEVEIDPCQSQPCSHGGSCEATAGPPPGFTCHCPTGFEG
PTCSHRAPFCGLHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPSPQGCGPPSPCL
HNGSCSETPGLGGPGFRCSCPPGSPGPRCQRPGAKGCEGRGGDGACDAGCSGPGGNWDGG
DCSLGIPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACSPAYDQYCHD
HFHNGHCEKGCNTAECGWDGGDCRPEAGDSQWGPSLALLVVLNPQALDQQLLALARVLSL
ILRVGLWVRKDSDGMDMVYPYPGPQAEEELGGTRDPSQQEAVAPPTLPLGKQTDSLSTGF
VVVMGVDLSRCGPEHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAAHPRAGTVAP
ANQLPWPVLCSPVAGVLLLALGALLVLQLIRRRRREHGALWLPPGFTQQPRTQRAPCRRR
PPLGEDSIGLKTLKPEAEAEDGVVMCSGSEEGEEVGQAEEMTPPSKCQLWTLSGDCGEIP
QTAMLTPPQESEMETPDVDICGPDGVTPLMSAVCCGGVESKTFQGAWLGGPEPWEPLLGG
GACPQAHAVGTGETPLHLAARFCRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAREV
CQLLLRSRQTAVDARTEDGTTSLMLAARLAVEDLVEELIAARADVGARDKWGKTALHWAA
AVNNARAARSLLQAGADKDAQDSRVRQGQRVLYKKVGVGGWKSAGTRTKRKGAGPAAKWV
ESRRTGPVSAALPDLFLLAVSSHAGADAAVLAAREGAVEGSQLLLGGGGGPRGCGTRPGL
APGDIARQRNHWDLLTLLEGAWPPEARHKATPGRGGGAFSCARIASGSVPPRGGGALPRT
RTQSAGAGPRRGGACLQARTLSVDLADPCGGAYSHCRSLSGGGAGGGAGGVPAPRGRRFS
AGARGPRPSPAIIRGRSGVAARRGGGPSAADWPCDWVALRARGPAPSTTIPPPCLTPSPE
RVSPQAAWGPQALNSGGEGQK
NT seq 6186 nt   +upstreamnt  +downstreamnt
atgcagcccccttcactgctgctgctgctgctgctgttgccaccgtgcttctcaattaac
aagaccagagggctgcggtgcgagagtttcctagaagcctgtgcaaatggaggcacttgc
ctgaccctgtctccggggcaagaggcctgccagtgtgcccctggcttctttggtgagacg
tgccagttccctgacccctgccaggatgcccagctatgccagaatgggggcagctgccaa
gtccagctccctgcccctccagtctcccctagcccaccctctcccttggcccccagcttc
ttctgcacctgccctcctggcttccttggcgagatgtgccaggcccgacttggggacccc
tgttttccctccttctgtcaaaaaaggggccgctgccacattcaggcctcaggccaccca
aggtgccactgcatgtctggatggacaggcgagtggtgccagctgcgggacttctgttca
gccaaaccctgtgccaatagaggggtgtgtctggccactcacccccagatccagtgtgac
tgccctcctggcttcacgggctatgcctgtgaacacgatatcaacgagtgcttcctggac
gccggaccttgccccaagggcacctcgtgccataacaccctgggctccttccagtgtctc
tgctccgctgcgcatgagggtccaccctgtgggctccaagcaggaccttgtccccccagc
ggctgtctcaatgggggaacctgtcagctggtcccagggggagactccaccttccacctc
tgcctctgtcccccaggtttcacaggcccagagtgtgaggtgaatccagatgactgtatt
gggcacgagtgtcagaatgggggtacttgccaggatgggttaagtaactacacctgcctc
tgcccagagacctggacaggctgggattgctctgaggacgtggacgaatgtgaggcccag
ggtccccctcactgcaaaaatgggggcacctgccagaactcacctggtagcttccactgc
gtgtgtgtgagtggctggggaggcacaggctgcgaggaaaacctggacgactgtgtcact
gccacctgtgccccaggatctacctgcattgaccgtgtgggctccttctcctgcctctgc
ccacctggccgcacaggcctcctgtgccacctggaggacatgtgtctgagtcagccgtgc
cacagagaagcccagtgcagcaccaaccccctgaagggctccaccctctgcctgtgtcag
ccaggctactctgggcccacctgccaccaggacctggatgagtgtgaaatggcccagcaa
ggccccagtccctgtgaacatggcggctcctgccacaacacccctggctctttcgactgc
gtctgtacccctggttacacgggttcccgctgtgaagctgatcacaacgagtgtctgtcc
caaccctgccacccaggcagcacctgcctggacctgcttgccaccttccactgcctctgc
ccaccaggcttggaagggcagctctgtgaggtggagacggatgagtgtgcctcggctcct
tgcctgaaccatgctgactgccatgacctgcgcaacggcttcctgtgtgtctgccagcct
ggattcactggcacgcgatgtgaggaagacatcgatgagtgtggaagctctccctgcgcc
aatggtggacagtgccaggaccagcctggagccttccgttgcaagtgtctcccaggcttt
gaaggcccccgctgtgagacagaggtggatgagtgtttgagtggcccatgccctactggt
gccagctgccttgatctcccgggagccttctcttgcctctgcccctctggcctcacaggc
cagttttgtgaggcccctctatgtgcccccaacctgtgccagcacaagcaagaatgccag
gatcaggaggacaaagctcactgcctctgccccgatggaagtcctggctgtgcccccact
gaggacaactgcacttgccaccatgggcactgccagaggtccttatgtgtgtgtgacatg
ggctggacagggccagagtgtgaggcagagctggggggctgcatctccatgccctgcgcc
catggggggacctgttccccccagccctctggctacaactgcacctgccctggaggctac
acagggcccacctgcagtgaggaggtaacagcatgtcactcaggaccctgtctcaatggt
ggctcctgcaatcccagccctgggggctactcctgcacctgcccaccaagccacacgggg
ctccgctgccagaccaacactgaccactgtgcctctgccccgtgcctcaatggaggtacc
tgtgtgaacaggcctggcactgcctcctgcctctgcgccatgggcttccagggcccacgg
tgtgaagaaaggatacgccccagctgtacagacagcccctgtaggaacagggcaacctgc
caagatggccctcagggtccccgctgcctctgtcccgctggctacacaggagatagctgc
caggccctggtggacttatgtgcccagaagccctgtccacacaacgcccgctgcctccag
actggacccgccttccagtgcctgtgcctccaaggatggactgggcctctctgtgacctt
caactatcctcctgccagagggccgctctgagccaaggcacagatgtctcctccctgtgc
cacaatggaggcctctgcatcgatagcggcccctcctatttctgccactgtccccctgga
ttccaaggcagcttatgccaggacagggtgagcccatgtgagtccaggccctgccagcat
ggggccacctgcgtggcccagcccaacgggtatctctgccagtgcaccccaggctacagt
ggacagaactgctcagaggaacccgatgcatgtcaatcccagccctgttacaaccatggg
acctgcacccccaaacctggaggcttccactgctcttgccctcctggctttgtgggcttg
cgctgtgagggggacgtggacgagtgtctggaccggccctgccaccccaggggcactgca
gcctgccaccctctggccaatgccttctactgccagtgtctgcctggacatacaggccag
tggtgtgaagtagagatagacccctgccagagccagccctgttcccatggagggtcctgt
gaggccacagcaggaccacccccaggtttcacttgccactgccccacgggttttgaaggc
cccacctgcagccacagagcccccttctgtggcctccatcactgccaccatggaggcctg
tgtctgccctcccctaagcccggcttcccaccccgctgtgcctgcctcagtggctatgga
ggtcctgactgcctgacccctccatctcctcaaggctgtggccccccatccccatgccta
cacaatggcagctgctcagagacacccgggttggggggcccaggctttcgatgctcctgc
cctcctggctctccagggccccggtgtcagaggccaggagccaaagggtgtgagggcaga
ggtggggatggagcctgtgatgctggctgcagtggcccagggggaaactgggacgggggg
gactgctccctgggaatcccggacccctggaagggctgcccctcccactcccggtgctgg
ctgctcttccgagatgggcagtgccacccgcagtgtgactctgaagagtgtctgtttgat
ggctacgactgtgagacccctccagcctgcagcccagcctatgaccagtactgccacgat
catttccacaatgggcactgtgagaaaggctgcaacactgccgagtgtggctgggacggg
ggcgactgcaggcctgaagctggggactcgcagtgggggccctccctggccctgctggtg
gtgctgaacccccaggccctggaccagcagctgcttgccctggcccgggtgctatccctg
atcctgagggtggggctctgggtgaggaaggacagtgatggcatggacatggtatacccc
tatcctgggccccaagctgaagaggagctgggaggaacccgggacccctctcagcaggag
gcagtagcccctccaacacttcccctgggcaagcagacagattctctcagcactgggttc
gtggtggtgatgggtgtggatttgtcccgctgtggccctgagcaccctgcatcccgatgt
ccctgggaccctgggctcctgctccgcttccttgccgccatggctgcggtgggggctctg
gagcccctactgcctggacccctcctggctgcccatcctcgtgcaggcaccgtggcccca
gccaaccagctcccctggcctgtgctgtgctctcctgtggctggggtgcttctcctggcc
ctcggggctcttcttgtcctccagctcatccggcgtcgacgccgagaacatggggccctc
tggctgccccctggtttcacacaacagccccgaactcagagagccccctgccgacgccgg
ccccccctgggcgaggacagtattggcctcaagactctgaagccagaggcagaagctgag
gatggagttgtgatgtgctcaggctccgaggagggcgaggaggtgggccaggctgaagaa
atgaccccaccttccaagtgccagctctggactctgagtggagactgtggagagatcccc
cagacagccatgctgactcccccgcaggagtctgagatggagacccctgatgtggacatt
tgtggacctgacggagtgacacccttgatgtcagcagtttgttgtgggggagtggagtcc
aagaccttccaaggggcatggttgggaggccctgagccatgggaacctctgctgggtgga
ggggcctgtccccaggctcatgccgtgggcactggggagacgcccctgcacctagctgcc
cgattctgccggccaaccgctgcccgtcgcctacttgaagctggagccaatcccaaccaa
ccagaccgggcaggtcgcaccccccttcacgctgctgtggctgctgatgctcgggaggtc
tgccagctcctgctccggagcagacagactgcagtggatgcacgcacagaagacgggact
acatccctgatgctggccgccaggctagcggtggaagacctcgttgaagaactgattgca
gcccgagcagacgtgggggccagagacaaatggggaaaaaccgcgctgcactgggccgcc
gccgtgaacaacgcccgggccgcccgctcacttctgcaggccggagccgataaagacgcc
caggacagcagggttagacaggggcagcgggttctctataaaaaagtgggcgtgggaggg
tggaaaagcgcgggaacccgtacaaaacgtaaaggggcggggccggcggcgaaatgggtg
gagtcacgaaggaccggccctgtgagcgcggcccttcctgacctcttcctcctggctgtt
tcctcccacgcaggagcagacgccgctgtcctggcggcacgagaaggggcagtggagggt
agccagcttctgctggggggtgggggcggcccgaggggctgcgggaccaggcccggacta
gcgcccggggatatcgcccgccaacggaaccactgggatctgctgacgctcctggaaggg
gcgtggccaccggaggcgcgtcacaaagccacgccgggccgcggagggggcgccttctcc
tgcgcgcggatcgcgtctggcagcgtgcccccgcgtggaggcggggctctgccgcgcact
cggacgcagtctgcgggagcaggccctcgacggggcggggcttgtctgcaagccaggact
ttgtccgttgacttggccgatccctgtggcggggcctattcacactgccggagcctatcg
ggaggaggagcgggaggaggagcaggaggagtcccggccccccgcggtcgtagattttcc
gcaggcgcgcgcgggcctcggcccagccctgcgataatacggggaagatccggggtcgcg
gcccggcgcgggggtgggccctcggcggctgactggccctgtgattgggtcgctctgaga
gcccgcggtcccgcccccagcactacgatcccgcctccttgccttactccgtccccggaa
cgggtatctcctcaagctgcttggggtccccaagcccttaattccgggggcgagggccaa
aaatag

KEGG   Loxodonta africana (African savanna elephant): 100659212
Entry
100659212         CDS       T04351                                 

Gene name
NOTCH1
Definition
(RefSeq) neurogenic locus notch homolog protein 1
  KO
K02599  Notch 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04330  Notch signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04919  Thyroid hormone signaling pathway
lav05020  Prion disease
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100659212 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100659212 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100659212 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100659212 (NOTCH1)
   05206 MicroRNAs in cancer
    100659212 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    100659212 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion disease
    100659212 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100659212 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100659212 (NOTCH1)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 FXa_inhibition EGF_3 cEGF EGF_MSP1_1
Other DBs
NCBI-GeneID: 100659212
NCBI-ProteinID: XP_003422786
LinkDB
Position
Unknown
AA seq 1273 aa
MPPLLAPLLCLVLLPAFPAARGLRCSQTGEETCLNGGKCEVFANGTEACLCSGAFVGQRC
QTSNPCLSAPCKNAGTCRVLEHGSTVDYACSCRLGFSGPLCLTPLDNACLTNPCRNGGTC
DLLTLNEYKCRCPPGWSGKTCQQADPCASNPCANGGQCLPFEASYICRCPPGFHGPTCRQ
DVNECSQTPRPCRNGGTCHNEVGSYHCTCRPTHTGPHCELPYQPCSPSPCQNGGTCRPTG
DTTHECACLPGFTGQNCEENVDDCPGNSCKNGGTCVDGVNTYNCRCPPEWTGQYCTEDVD
ECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCANAACFHGATCHDRVASF
YCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECS
LGANPCEHAGRCINTQGSFECQCLQGYTGPRCEIDVNECVSSPCQNDATCLDQIGEFQCI
CMPGYEGVYCELNTDECASSPCLHNGRCLDKINEFHCECPTGFTGHLCQYDVDECASTPC
KNGAKCLDGPNTYTCVCTEGAARRPVRAGAGDAGQDVLPQGSEGGRRPGTLNPAQRADPN
INECHSQPCRHGGTCQDRDNAYLCLCLKGTSGPNCEVNLDDCASNPCDSGTCLDKIDGYE
CACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINSFTCRCPEGYHDPTCLSEVNECGSN
PCIHGACRDGLNGYKCDCDAGWSGANCDINNNECESNPCVNGGTCKDMTSGYVCTCREGF
SGPNCQTNINECASNPCLNQGTCIDDVAGYTCNCLLPYTGATCEVVLAPCAPSPCRNGGE
CRESEDYESFSCVCPTGWQGQTCEIDINECVKSPCRHSASCQNTNGGYRCHCLAGYTGRN
CETDIDDCRPNPCHNGGSCTDGINAAFCDCLPGFQGTFCEEDINECASNPCRNGANCTDC
VDSYTCTCPAGFSGIHCEDNTPDCTESSCFNGGTCVDGISSFTCLCPPGFTGSYCQHDIN
ECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQSLVHWCDSSPCKNGGKCWQANTLYHC
DCHSGWTGLYCDVPSVSCEVAARQQEVDVTHLCQHGGLCMDTGNTHHCRCQPGYTGSYCE
DQVDECSPSPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINECLSRPCQNGGTCIDLTN
TYKCSCPRGTQGVHCEINVDDCIPAVEPGTRSPKCFNNGTCVDQVGGYSCICPPGFVGER
CEGDVNECLSNPC
NT seq 3819 nt   +upstreamnt  +downstreamnt
atgccgccgctcctggcgccgctgctctgcctggtgctgctgccggcgttccccgctgca
cgaggcctgcgatgttcccagactggtgaggagacctgcttgaatggcgggaagtgtgaa
gtgtttgccaatggcacggaggcctgtctctgcagcggggccttcgtgggtcagcggtgc
cagacatccaacccctgcctcagcgcaccctgcaagaacgccgggacgtgccgtgtgctg
gagcacggcagtacagtggactacgcctgcagctgccggctgggcttctccggcccgctc
tgtctgacgcctctcgacaacgcctgcctcaccaacccctgccgcaacggcggcacctgt
gacctgctcacgctcaatgagtataagtgccgctgccccccgggctggtcagggaagaca
tgccaacaggccgacccctgcgcctccaacccctgtgccaatggcggccagtgtctgccc
ttcgaggcctcatacatctgccgctgcccgcctggcttccatggccccacctgccggcag
gacgtgaatgagtgtagccagacccccaggccttgccgcaacgggggcacctgccacaat
gaagtcggctcctaccactgcacctgccgccccacccacaccggcccccactgcgagctg
ccctaccagccttgtagcccctctccctgccagaacggaggcacctgccgccccactgga
gacaccacccacgagtgcgcctgcctgccaggtttcaccgggcagaattgtgaggagaac
gtggacgactgcccagggaacagctgcaagaacgggggtacctgtgtggatggtgtcaac
acctacaactgccgctgcccacctgagtggacaggccagtactgtacggaggatgtggat
gagtgccagctgatgcccaacgcctgccagaacggcggcacctgccacaacacccatggc
ggctacaactgcgtgtgtgtcaatggctggaccggcgaggactgcagtgagaacatcgac
gactgtgccaatgccgcctgcttccacggcgccacctgccatgaccgtgtggcctccttc
tactgcgagtgcccccatggccgcacaggtcttctctgccacctgaacgatgcctgcatc
agcaacccctgcaacgagggttccaactgtgacaccaaccctgtcaatggcaaagccatc
tgcacctgcccctcagggtacacggggcccgcctgcagccaggatgtggacgagtgctct
ctgggcgccaacccctgtgagcacgcaggcaggtgcatcaacacccagggctccttcgag
tgccagtgtctgcagggctacacaggcccacgctgcgagatcgatgtcaatgagtgtgtc
tccagcccctgtcagaatgatgccacctgcctggaccaaatcggggagttccagtgtatc
tgcatgcctggctacgagggcgtctactgtgagctcaacacggacgagtgcgccagcagc
ccttgcctgcacaatggccgctgcctagacaagatcaatgagttccactgcgagtgcccc
actggcttcacggggcacttgtgccagtatgacgtggatgagtgtgccagcacgccctgc
aagaacggcgccaagtgcctggacgggcccaacacgtacacctgcgtgtgcacggaaggt
gcggccaggcgccccgtcagggccggagcaggggatgcgggacaggatgtcctgcctcag
gggagtgaggggggcaggagacctgggacactgaatccagcacagcgtgctgaccccaac
atcaacgagtgccatagccagccctgccgccatgggggcacctgccaggaccgcgacaat
gcctacttgtgcctctgcctcaaggggacctcagggcccaactgtgaggtcaatctagac
gactgtgccagcaacccctgcgactcgggcacctgcctggacaagatcgacggctacgag
tgtgcgtgcgagcctggctacacagggagtatgtgcaacatcaacatcgacgagtgtgcg
gggaacccctgtcacaatgggggcacctgtgaggacggcatcaatagcttcacttgccgc
tgccccgagggctaccacgaccccacctgcctgtcagaggtcaacgagtgtggcagcaac
ccctgcatccacggtgcctgccgggatgggctcaacgggtacaagtgtgactgtgacgct
ggctggagtggggccaactgtgacatcaacaacaatgagtgcgagtccaacccctgcgtc
aatggtggcacctgcaaggacatgaccagcggctatgtgtgcacatgccgggagggcttc
agcggccccaactgccagaccaacatcaacgagtgcgcatccaacccgtgtctgaaccag
ggcacatgcatcgatgacgtggccggctacacgtgcaactgcctgctgccctacacggga
gccacgtgtgaggtggtgctggccccgtgtgcccccagcccctgcaggaatggtggcgag
tgcagagagtctgaggactacgagagcttctcctgcgtctgtcccacaggctggcaaggg
cagacgtgtgagatcgacatcaatgagtgtgtgaagagcccgtgccggcacagcgcctcc
tgccagaacaccaatggtggctaccgctgccactgcctggcaggctataccggacgcaac
tgtgagacagacattgacgactgccggccgaacccgtgccacaatggtggctcctgcacg
gatggcatcaatgcagccttctgcgactgcctgccgggcttccagggcaccttctgtgag
gaggacatcaacgagtgcgccagcaacccctgccgcaacggcgccaactgcacggactgc
gttgacagctatacgtgcacttgccctgccggcttcagcgggatccactgcgaggataac
acgcctgactgcaccgagagctcctgcttcaacggcggcacgtgtgtggatggcatcagc
tccttcacctgcctatgtccacctggcttcacgggcagctactgccagcatgacatcaac
gagtgtgactcacgaccctgtctgcacggcggaacctgccaggacagctatggcacctat
aagtgcacctgccctcagggctacactggcctcaactgccagagcctggtacactggtgc
gactcctcgccttgcaagaatggcggcaagtgctggcaggccaacacactgtaccactgc
gactgccacagtggctggactggcctctactgcgacgtacccagcgtgtcctgtgaggtg
gctgcgcggcagcaagaggtcgacgtcacccacctgtgccagcacggggggctgtgcatg
gacacgggcaacacccaccactgccgctgccagcccggctacaccggcagctactgtgag
gatcaggtggacgagtgctcgcccagcccctgccagaacggagccacctgcaccgactac
ctgggtggctactcctgcgagtgtgtagctggctaccacggggtgaactgctccgaggag
atcaacgagtgcctgtcccgcccgtgccagaatgggggcacctgcatcgacctcaccaac
acctacaagtgctcctgccctcggggcacacagggcgtgcactgtgagatcaacgtggat
gactgcatcccggctgtggagccaggtacgcggagccctaagtgcttcaacaacggcacc
tgcgtggaccaggtgggcggctacagctgcatctgcccacctggctttgtgggcgaacgc
tgcgagggtgacgtcaacgagtgcctgtccaacccctgt

KEGG   Loxodonta africana (African savanna elephant): 100661550
Entry
100661550         CDS       T04351                                 

Gene name
NOTCH3
Definition
(RefSeq) LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 3
  KO
K20995  Notch 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04330  Notch signaling pathway
lav04371  Apelin signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04919  Thyroid hormone signaling pathway
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100661550 (NOTCH3)
   04371 Apelin signaling pathway
    100661550 (NOTCH3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100661550 (NOTCH3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100661550 (NOTCH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100661550 (NOTCH3)
   05206 MicroRNAs in cancer
    100661550 (NOTCH3)
  09162 Cancer: specific types
   05224 Breast cancer
    100661550 (NOTCH3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100661550 (NOTCH3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100661550 (NOTCH3)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Notch Ank Ank_5 NODP NOD DUF3454 Ank_4 Ank_3 EGF_2 cEGF EGF_3 FXa_inhibition
Other DBs
NCBI-GeneID: 100661550
NCBI-ProteinID: XP_023407633
LinkDB
Position
Unknown
AA seq 2287 aa
MSWGPRLPEPPHLAQAAPPPARSRFRGSLHPRRHPQLGTAVVEGGGEGRGLPLWGLADPH
LPLSPPTASPCLDGSPCVNGGRCTQLPTREAACLCPPGWVGERCQLEDPCHSGPCAGRSV
CQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDXRYVCSCPAGYQG
RSCRSDVDECRAGGPCRHGATCLNTPGSFRCQCPAGYMGPLCENPAMPCAPSPCRNGGTC
RQSGEHTYDCACLPGXXXXXXEVNVNDCPGHRCLNGETCVDGVNXYNCQCPPEWTGQFCT
EDVDECQLQPNACHNGGTCFNTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDR
VASFYCACPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDV
DECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDINECLSGPCRNQATCLDRIGQ
FTCICMAGFTGTFCEMDIDECQSSPCVNGGICKDRVNGFSCTCPSGFSGATCQLDVDECA
STPCKNGAKCVDQPDGYECHCAEGFEGTLCERNIDDCSPDPWPHGXCGNGFPDFLVACAP
GYTGTRCKSQVDECRSQPCRHGGKCLNLVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFG
ICRDGINRYDCVCQPGFTGPLCNVDINECASSPCAEGGSCVDGENGFRCLCPLGSLLPLC
LPPSHPCAQEPCSHGVCHDAPGGFRCVCEPGWSGPRCGQSLAQDACESQPCGASGTCTSD
GVAFHCTCPPGIQGRQCELPSPCIPNPCENGGHCESAPGQLAVCSCPPGWQGPRCQQDVD
ECAGSSPCGPHGTCTNLAGTFSCTCHGGYGGPSCDQDIDDCDPNPCLNGGLCQDGVGSFS
CSCLPGFAGPRCAHDVDECLSSPCGLGTCTDHVASFTCTCPPGYGGFHCERDLPDCSPSS
CFNGGTCIDGVNSFSCLCRSGYTGSHCQHQVDPCLSRPCLNGGVCSTAHPGFHCACPQGF
TGNQCQTLVDWCSRAPCQNGGRCAQTGASFYCLCPPGWSGRLCDIRSLPCREAAAQIGVR
PEQLCQAGGRCVDEGSAHYCLCPDGRTGSHCEQEVDPCLAQPCQHGGTCRGYMGGYMCEC
PAGYTGDNCEDDVDECASQPCQHGGSCIDLVARYLCSCPPGTLGVLCEINEDDCSLGPPQ
ELGPLCLHNGPRCQTVLSPCEFQPCQHGGQCRPXPGQGGALTFACHCVPPFWGPRCERVA
SSCRELQCPVGVPCQQTVRGPRCACPPGLSGPSCRGSRGSLPGATNSSCAAAPCLHGGSC
RPAPLAPFFLCSCAPGWAGPRCETPAALPEAPEEPRCPLAACRAKRGDRRCDRECNSPGC
GWDGGDCTLSVGDPWRQCAALQCWRLFNNSRCDPACSSPACLYDNFDCRTGGRERTCNPV
YEKYCADHFADGQCDQGCNMEECGWDGLDCAMEVPALLARGVLVLTVLLPPEELLRSSAD
FLQRLSAILRTSLRFRLDGNGQAMVFPYHRPSTEPRARRELVPEVIGSVVMLEIDNRLCL
QSSENDHCFPDAQSAADYLGALSAVERLDFPYPLRAVRAEPLELPEPSVPLLPLLAAGAV
FLLVILVLGVMVARRKREHSTLWFPEGFTLHKDAAAGHKGRREPVGQDALGMKNMAKGES
LMGEVASDWMDTECPEAKRLKVEEPSVGAEDAVDCRQWTQHHLVAADIRMAPAMALTPPQ
GDVDADGMDVNVRGPDGFTPLMLASFCGGALEPMPAEEDEADDTSASIISDLICQGAQLG
AQTDRTGETALHLAARYARADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILI
RNRSTDLDARMADGSTALILAARLAVEGMVEELIASHADVNAVDELGKSALHWAAAVNNV
EATLALLKNGANKDMQDSKEETPLFLAAREGSFEAAKLLLDHFANREITDHLDRLPRDVA
QERLHQDIVRLLDQPSGPRSPPGPHGLGPLLCPPGAFLPGLKAAPSGGKKNRRPPGKAGL
GPQGTRGRGKKLTLACPGPLADSSVTLSPVDSLDSPRPFGGPPASPSGFPLEGPYAAATA
TAVSLAQLGGSGRAGLGRQPPGGCVLSLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPG
PQLLNPGTPVSPQERPPPYLAALGHGEEYVAAGSHSSPRKAHFLRVPSEHPYLTPSPESP
EHWASPSPPSLSDWSDSAPSPATASGATAAGTLPAQTLPLTVPGPLTQTQTQLGPHPEVP
PKRQVLA
NT seq 6864 nt   +upstreamnt  +downstreamnt
atgtcctggggccccaggcttcctgagcccccacatctggcacaggcagccccacctcct
gcccgctcccgctttaggggctccctgcacccgcggagacacccccagctcggcacagct
gttgttgaggggggtggggagggaaggggtctgccactctggggcctggctgaccctcac
cttcctctgtcgccccccacagcctccccttgcctggatgggagcccatgtgtgaatgga
ggtcgctgcacccagctgcccacgcgggaggctgcctgtctgtgtccgccaggctgggtg
ggtgagcggtgccagctggaagacccctgccactcaggcccctgtgctggccgaagtgtg
tgccagagctcggtggtggcgggcactgcccgcttctcctgccgctgtcctcgtggtttc
cgaggcccggactgctccctgccagacccctgcctcagcagcccctgtgcccatggtgcc
cgctgctctgtggggccggatngacgctacgtctgttcctgcccggctggctaccagggc
cgcagctgccgcagtgatgtggatgagtgccgggcgggtgggccctgccgccatggggcc
acctgtctcaacacgccgggctccttccgctgccagtgcccagctggctacatggggcca
ctgtgtgagaaccctgctatgccctgtgccccatcgccgtgccggaatgggggcacctgc
cggcagagtggtgagcacacctacgactgtgcctgccttcccggnnnnnnnnnnnnnnnn
nntgaagtgaatgtgaacgactgtccaggacaccggtgcctaaatggagagacgtgtgtg
gatggtgtgaacnactacaactgccagtgccccccagagtggacaggccagttctgcacg
gaggacgtggacgagtgtcagctgcagcccaatgcctgccacaatgggggcacctgcttc
aacacgttgggtggccacagctgcgtgtgtgtcaacggctggacaggtgagagctgcagc
cagaacattgatgactgtgccacagccgtgtgcttccacggggctacctgccatgaccgt
gtggcttccttctactgtgcctgtcccatgggcaagacagggctcctttgccaccttgat
gatgcctgtgtcagtaacccctgtcacgaggatgccatctgtgacaccaatccagtgaat
ggccgggccatctgcacctgccccccaggcttcacaggaggggcctgtgaccaggatgtg
gacgagtgctccatcggagccaacccctgtgagcatctgggccggtgtgtgaacacacag
ggctcattcctgtgccagtgtggccgcggctacacaggcccacgctgcgagaccgacatc
aacgagtgcctgtcggggccctgccgcaaccaggccacatgcctggaccgcatcggccag
ttcacctgcatctgtatggcaggtttcacaggcacattttgcgagatggacattgacgag
tgtcagagcagtccgtgcgtcaacggtggcatctgcaaggaccgcgtcaatggcttcagc
tgcacctgtccctcaggcttcagtggcgccacgtgccagctggatgtggacgagtgcgcc
agcacgccctgcaaaaatggcgccaagtgcgtcgaccagcctgacggctacgagtgccac
tgcgcagagggctttgagggcaccctgtgtgagcgaaacatcgacgactgctctccagac
ccttggccccacgggncctgtgggaacggattccccgatttcttggtggcttgcgccccg
ggctacaccggcacgcgctgcaaaagccaggtggatgagtgccgcagccaaccctgccgc
cacgggggaaaatgcttaaacctagtggacaaatacctctgccgatgcccaccgggcacc
acaggtgtgaactgtgaggtgaacatcgatgactgtgccagcaacccctgcacctttggc
atctgccgtgatggcatcaaccgctatgactgtgtctgccagcctggcttcacagggccc
ctctgcaatgtggacatcaacgagtgcgcttccagcccctgcgctgagggaggctcctgt
gtggatggagaaaatggcttccgctgcctgtgccccctgggctccctgcttccactctgc
ctcccacccagccacccctgtgcccaggagccctgcagtcacggtgtctgccatgatgcg
cctggcgggttccgctgcgtgtgtgagcctggctggagtggccccaggtgtggccagagc
cttgcccaggatgcctgtgagtcccagccctgtggggccagtggcacctgcaccagcgat
ggagtggccttccactgcacctgtcccccaggcatccagggccgccagtgtgagctgccg
tctccctgcatcccgaacccctgtgagaatgggggccactgtgagtctgcccctggccag
ctggctgtctgctcctgcccccctggctggcaaggcccacgatgtcagcaagacgtggat
gagtgtgcaggctcctcaccctgtggcccccatggaacctgcaccaacctggcagggact
ttcagctgcacctgccatggggggtatggtggcccttcctgcgatcaggacatcgatgac
tgtgaccccaacccatgcctgaatggcggcttgtgtcaggatggcgtgggctccttttcc
tgctcctgcctccctggcttcgctggcccccgctgtgcccacgatgtggacgagtgtctg
agcagcccctgtggcctgggcacctgcaccgaccacgtggcctccttcacctgcacctgc
cctcctggctatggaggatttcactgtgaacgggacttgccagactgcagccccagctcc
tgcttcaacggaggcacctgcattgacggcgtcaactccttcagctgcctgtgccgctct
ggctacacaggctcccactgccaacatcaggtcgacccctgcctgtctcggccctgcctg
aatgggggcgtctgcagcaccgcccacccgggcttccactgcgcctgcccccagggcttc
actggcaaccagtgccagacgctggtagattggtgcagccgcgcgccctgtcagaacggg
ggtcgctgtgcccagactggcgcctccttctattgcctttgccccccggggtggagcggc
cgcctctgcgacatccggagcctgccttgcagggaggccgcagcccagatcggtgtacgg
ccagagcagctgtgccaggcaggcgggcggtgtgtggacgagggcagtgcccactactgc
ttgtgtccagatggccgcacaggcagccactgtgagcaggaagtggacccctgcctggcc
cagccctgccagcatgggggcacctgccgtggctacatgggaggctacatgtgtgagtgc
ccagctggctacactggtgacaactgtgaggatgatgtggacgagtgtgcctcccagccc
tgccagcatggggggtcctgcatagacctggtggcccgctatctctgctcctgcccccct
gggacgctaggtgtgctctgtgagatcaatgaggacgactgcagcctaggcccaccccag
gagctgggccccctgtgtctgcacaatggtccgcgctgtcagaccgtcctgtcgccctgc
gagttccagccttgccaacacggaggccagtgccgccccnagccgggtcaggggggtgcg
ctaaccttcgcctgccactgtgtcccacccttctggggcccgcgttgcgagcgagtggcg
agctcctgtcgggagctgcaatgcccagtgggcgtcccgtgccagcagacggtccgcggg
ccgcgctgcgcctgccccccggggctgtcggggccctcctgtcggggctcgcgggggtcg
ctgccgggggccaccaactccagctgcgcagccgccccctgcctgcacgggggctcgtgc
cgccccgcaccactcgcgcccttcttcctctgttcgtgtgccccgggctgggccgggcca
cgctgcgagacgccagctgcgctccctgaggcgcccgaggagccgcggtgcccgcttgcc
gcctgccgcgccaagcgcggggaccgccgctgcgaccgcgagtgcaacagcccgggctgc
ggctgggacggcggcgactgcacgctgagcgtcggcgacccctggcggcagtgcgcggca
ctgcaatgctggcgcctcttcaacaacagccgctgcgaccccgcctgcagctcaccggct
tgcctttatgacaacttcgactgccgcactggaggccgggagcgcacctgcaaccccgtg
tatgagaagtactgcgcagaccactttgccgatggccaatgcgaccagggctgcaacatg
gaggaatgcggctgggacgggctggactgcgccatggaggtgccggcactgctggcgcgc
ggcgtgctggtgctcaccgtgctgctgccgcccgaggagctgctgcgctctagcgccgac
ttcctgcagcggctcagtgccatcttgcgcacctcgctgcgcttccgcctggacgggaac
ggccaggccatggtcttcccttaccaccggcctagcaccgagccgcgtgcccggcgggag
ctggtcccagaagtgattggctctgtagtcatgctggagattgacaaccggctgtgccta
cagtcatctgagaatgaccactgcttccctgatgcccagagcgcagccgactacctgggt
gccctgtcggctgtggagcgcctagacttcccgtacccgctgcgggctgtgcgtgctgaa
ccgctggagctgccagagccgagtgtgccactgctgcccctgctggccgcgggtgccgtc
ttcctcctggttatccttgtcctgggtgtcatggtggcccggcgcaagcgcgagcacagc
accctgtggttccctgagggcttcacattgcacaaggatgctgcagcaggccacaagggc
cggcgggagccagtaggccaggatgcgctgggcatgaagaacatggccaagggtgagagt
ctgatgggggaggtggcctcagactggatggacaccgagtgcccggaggccaagagactg
aaggtagaggagcccagcgtgggggctgaggatgctgtggactgccgccagtggactcaa
caccacctggttgctgctgacatccgcatggcaccagccatggcactgacaccaccacag
ggggacgtggatgctgacggcatggatgtcaatgtgcgtggaccagatggcttcacccca
cttatgctggcctccttctgtgggggagccctggagccgatgccggcagaggaggatgag
gccgatgacacatcagccagcatcatctcggacctgatctgccagggtgcccagcttgga
gcacagactgaccgcactggtgagactgccctgcacctggccgcccgctacgcccgagcc
gacgcagccaagcggctgctggatgcaggcgcagacaccaatgcccaggaccactcgggc
cgcacccccctgcacacggctgtcaccgccgacgcccagggtgtcttccagattctcatc
cggaaccgctccacagacctggatgcccgcatggcagacggctccacagcactgatcctg
gcagcccgcctggcagtggagggtatggtggaagagctcattgccagccacgcggatgtc
aatgctgtggatgagctcgggaaatcagctttacactgggctgctgccgtcaacaatgtg
gaggccaccttggccctgctcaaaaatggagccaacaaggacatgcaagacagcaaggag
gagacgcctctgttcctggctgcccgtgagggcagctttgaggccgccaagctgctgctg
gaccatttcgccaaccgtgagatcacagaccacctggaccggctgccacgagacgtggcc
caggaacggctgcaccaggacatcgtgcggctgctggaccagcccagtgggccccgaagc
cctcccggcccccatggcctgggccccctgctctgcccacctggagccttcctcccaggc
cttaaggcagcaccgtcagggggcaagaagaatcgaagaccccctgggaaggcagggctg
gggccacaggggacccggggacgaggcaagaagctgacgctggcctgcccagggccactg
gcggacagctcggtcaccctctcgcctgtggactcgctggactccccacggcccttcggg
ggccctcctgcctcccccagcggcttcccccttgaggggccctatgcagccgccaccgcc
acagcagtgtctctggcgcagctcgggggctccgggcgggcgggtctagggcgccagcca
ccagggggctgtgtgctcagcctgggtctcctgaaccctgtggcggtgccccttgactgg
gcccgcttgcccccaccggccccaccaggcccctccttcctgctgccactggccccgggc
ccccagctgctgaaccctgggacccccgtttccccccaggagcggcccccaccatacctt
gctgccctgggacacggtgaggaatatgtggcagctgggtcccacagcagcccccgcaag
gcccactttctgcgggtccccagtgagcacccttacttgaccccctctcctgagtcccca
gagcactgggccagcccgtcgcccccctccctctcggactggtccgactcagcaccaagc
cctgccacagcttccggggccacggccgcagggacactgcctgcccagaccctccccctg
actgtccctggccccctcacccagacccagacccaactggggccccaccctgaggtcccc
cccaagaggcaggtgttggcctga

KEGG   Loxodonta africana (African savanna elephant): 100665966
Entry
100665966         CDS       T04351                                 

Gene name
NOTCH2
Definition
(RefSeq) neurogenic locus notch homolog protein 2 isoform X2
  KO
K20994  Notch 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04330  Notch signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04919  Thyroid hormone signaling pathway
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100665966 (NOTCH2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100665966 (NOTCH2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100665966 (NOTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100665966 (NOTCH2)
   05206 MicroRNAs in cancer
    100665966 (NOTCH2)
  09162 Cancer: specific types
   05224 Breast cancer
    100665966 (NOTCH2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100665966 (NOTCH2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100665966 (NOTCH2)
SSDB
Motif
Pfam: EGF hEGF EGF_CA DUF3454 Ank_2 EGF_2 NOD Notch Ank Ank_5 NODP Ank_3 Ank_4 EGF_3 Elf-1_N
Other DBs
NCBI-GeneID: 100665966
NCBI-ProteinID: XP_010587927
LinkDB
Position
Unknown
AA seq 2471 aa
MPALRPARLWALLALWLCRTAPAHALQCRDGYEPCVNEGICVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCAPGFTGEECQYSTSHPCFMSRPCLNGGT
CHMLSRDTYECTCQVGFTGMLCQWTDACLSHPCANGSSCTTVANQFSCKCLAGFTGQKCE
TDINECDIPGRCQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTAGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGINCEINFDDCASNPCVHGVCK
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCVNDVNSFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCVCDAGWVGINCEVDKNECLSNPCQNGGICDNLVNGYR
CTCKKGFKGHNCQVNIDECASNPCLNQGTCSDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKEAPNFESYTCLCTPGWQGQRCTIDIDECVSKPCMNLGICHNTPGSYMCECP
PGFSGMDCEEDINDCLANPCQNGGSCVDGVNTFFCLCLPGFIGDKCQTDMDECLSEPCKN
GGTCSDYVSSYTCKCQAGFDGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGP
FCLHEINECNSHPCLNEGTCVDGLGTYRCVCPLGYTGKNCQTLVNLCSRSPCKNKGTCIQ
DKAEFRCLCPSGWAGAYCDVPSVSCEVAASHRGLPVDRLCQHSGICISAGNTHHCQCPMG
YTGSYCEEQLDECASNPCRHGATCSDFIGGYRCECIPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFMDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPNPQDCEPGCAS
SPCQHGGTCYPQRQPPYYSCQCPSRFWGSHCELYTAPTSMPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQRNS
KTCKYDKYCADHYKDNHCDQGCNSEECGWDGLDCAADQPEKLAEGTLVIVVLMPPEQLLQ
DARSFLRALGALLHTNLRIKRDAQGALMVYPYYGEKSAAMKKQRMTRRSLPVEEEQEVAG
SKIFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVISESWTPKSTQLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDAEGPQPKKAKGEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSFAPTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDMSDEDEEAEDSSANIIT
DLVGQGASLQAQTDRTGEMALHLAARYSRADAAKHLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRATDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATILLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKPRRPNAKSAMPTSLPHLAKEAKDAKGNRRKKSLSDKGQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPPNPMLATAAPPAPAHSQHALSFSNLHEMQPLAHGASTVLP
SVSQLLSHHHIVPPGGGSAGSLGRLHPVTVPADWMNRMEMNETQYSEMFGMVLTPAEGTH
PGIAPQNRPPDGKHITPREPLPPIVTFQLIPKGSIAQPAGAPQPQSNCPPTVAGPLPTMY
QIPEMARLPNVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMS
EPPHSNMQVYA
NT seq 7416 nt   +upstreamnt  +downstreamnt
atgcctgccctgcgccccgctcggctgtgggcgctgctggcgctctggctgtgccgcacc
gcccccgcgcatgcattgcagtgtcgggatggctatgagccctgtgtaaatgaaggcata
tgtgttacttatcacaatggcacaggatactgcaaatgtccagagggcttcttgggagaa
tattgtcaacatcgagacccctgtgagaagaatcgctgccagaatggtgggacctgtgtg
gcccaggccatgttggggaaagccacatgccgatgtgccccggggttcacaggcgaggag
tgccagtactccacctcccacccgtgcttcatgtctcgcccctgcctgaacggaggcacc
tgccatatgctcagccgggatacctatgagtgcacctgccaagttggttttacaggtatg
ctgtgccagtggactgatgcctgcctgtctcatccctgtgcaaatggaagttcctgtacc
actgtggccaaccagttctcctgcaaatgtctcgcaggcttcacagggcagaagtgtgag
actgacattaatgaatgtgacattcccgggcgctgccagcatggtggcacctgcctcaac
ctgccaggttcctatcagtgccagtgcccccagggcttcacagggcagcactgtgacagc
ccctatgtgccctgcgccccctccccctgtgtcaacggaggtacctgccggcaaactggt
gacttcacttttgagtgcaactgccttccaggttttgaagggagcacctgtgagcggaat
attgacgactgccctaaccacaagtgtcagaatggaggagtttgtgtggatggggtcaat
acttacaactgccgctgcccacctcagtggactggacaattctgcactgaagatgtggat
gaatgtcttctacaacccaatgcctgtcagaatgggggcacctgtaccaaccgcaatggg
ggctacggctgcgtgtgtgttaatggctggagtggagatgactgcagtgagaacatcgat
gactgtgccttcgcctcctgcactgcaggctccacctgcattgaccgtgtggcctccttc
tcttgcatgtgcccagaaggaaaggcaggtctcttgtgtcatctggatgatgcatgcatc
agcaatccttgccacaagggggcactgtgtgataccaaccccctgaacgggcagtatatt
tgcacctgcccacaaggctacaaaggggctgactgtacagaagatgtggatgagtgtgcc
atggccaacagcaacccatgtgagcatgcagggaaatgtgtgaatacagatggcgccttc
cactgtgaatgtctgaagggctatgcagggcctcgctgtgagatggatatcaatgagtgc
cattcagacccctgccagaacgatgccacctgcttggataagattggaggattcacatgt
ctgtgcatgccaggtttcaaaggtgtgcattgtgaattggagataaatgaatgtcagagc
aacccttgtgtgaacaatgggcagtgtgtggataaagtcaatcgctttcagtgtctgtgt
ccgcctggtttcactgggccagtttgccagattgatattgatgactgttccagtactcca
tgtctgaatggggcaaagtgtatcgatcacccaaatggatatgaatgccagtgtgccaca
ggcttcactggtgtgttgtgtgaggagaacatcgacaactgtgaccctgatccttgccac
catggccagtgccaggatggtattgattcctacacctgcatctgcaatcccggatacatg
ggtgccatctgcagtgaccagattgatgaatgctacagcagcccttgcttgaatgatggt
cgctgcatcgacctggtgaatggctaccagtgcaactgccaaccaggcacgtcagggatt
aactgtgaaattaattttgatgactgcgcaagtaatccttgtgtccatggagtctgtaaa
gatggcattaaccgctacagctgtgtctgctcacccggattcacagggcagagatgtaac
attgacatcgatgagtgtgcttccaatccctgtcggaagggtgcaacgtgtgtcaatgat
gtgaacagttttcgctgtatatgccccgaggggccccatcaccccagctgctattctcag
gtgaatgagtgcctgagcaatccttgcatccatggaaactgcactggtggcctcagcgga
tacaagtgtgtctgtgatgcaggctgggttggtatcaactgtgaagtggacaaaaatgaa
tgtctttctaacccatgccagaacggaggaatttgtgacaatctggtgaatggatacaga
tgtacttgcaagaagggctttaaaggccataactgtcaggtgaatattgatgaatgtgct
tcaaatccatgcctgaaccaaggaacctgctctgatgacataagtggctacacttgccat
tgtgtgctcccatacacaggcaagaactgtcagactgtattggctccctgttctccaaac
ccttgtgagaatgctgctgtttgcaaagaggccccaaattttgagagttatacctgtctg
tgcactcctggttggcaaggtcagcggtgtacaattgacattgacgagtgtgtctccaag
ccctgcatgaaccttggcatctgccataacaccccaggcagttacatgtgcgagtgccct
ccaggcttcagtggtatggactgtgaggaggacatcaatgactgccttgccaatccttgc
cagaatggagggtcctgtgtggatggagtcaatactttcttctgcctctgccttccgggg
ttcattggggacaagtgccagacagacatggatgagtgtctgagtgagccctgtaagaat
ggagggacctgctccgactatgtcagcagttacacctgcaagtgtcaggcgggatttgat
ggagtccactgtgagaacaacattgatgagtgcacggagagctcctgtttcaatggtggc
acgtgtgttgatgggattaactccttctcctgcttgtgccctgtgggcttcactggcccc
ttctgcctccatgagatcaatgaatgcaactctcacccatgcctgaatgagggaacgtgt
gttgatggcctgggtacctaccgctgtgtctgtcccttgggctacactgggaaaaactgt
cagaccctggtgaacctctgcagccggtctccatgtaaaaacaaaggtacctgcattcag
gacaaagcagagtttcggtgcctgtgtccctctggatgggctggtgcctactgtgacgtg
cccagtgtctcctgtgaggtggcagcctcccacagagggttgcctgtcgaccgtctgtgc
cagcactctgggatctgcatcagcgccggcaacacacatcactgccagtgccccatgggc
tacaccgggagctactgtgaggagcagctggatgagtgcgcgtccaatccctgccggcac
ggagccacctgcagcgacttcattggtggataccgatgcgagtgtatcccaggatatcag
ggtgtcaactgtgaatatgaagtggatgagtgccagaatcagccatgccagaatggaggc
acctgtatcgaccttgtgaaccatttcaagtgctcctgccctccaggcactcggggcctg
ctttgtgaagagaacattgacgattgtgccaggggcccccactgccttaatggtggtcag
tgtgtggataggatcgggggctacagttgtcgctgcttgcctggctttgctggtgagcgg
tgtgagggggacatcaacgagtgcctctccaacccctgcagctctgagggcagcctggat
tgcatacagcttaccaacgactacctgtgtgtctgccgcagcgccttcactggccgtcac
tgtgaaaccttcatggatgtgtgtccccagatgccttgcctcaatggagggacttgtgct
gtggccagcaacatgcctgatggtttcatttgtcgttgtcccccgggattctccggggca
agatgccagagcagctgtggacaagtgaagtgtaggaaaggggagcagtgtgtgcacaca
gcctcaggaccccgctgcttctgcccaaatccccaggactgcgagccaggctgtgccagc
agcccctgccagcacgggggcacctgctatcctcagcgccagcccccttattactcttgc
cagtgcccttcccggttctggggcagccactgtgagctctacacagcccccaccagcatg
cctcccgccacctgtctcagccagtattgcgcagacaaagcccgggacggcgtctgtgat
gaggcctgcaacagtcatgcctgccagtgggatgggggcgactgctctctcaccatggag
aacccctgggccaactgctcctccccacttccgtgctgggattacatcaacaaccagtgt
gacgagctgtgcaacacggctgagtgcctctttgacaactttgaatgccagaggaacagc
aagacatgcaagtatgacaaatattgtgcagaccactacaaagacaaccactgtgaccag
ggatgcaacagcgaggagtgtggctgggatgggctggactgtgctgctgaccagccagag
aagctggcagagggaaccctggttattgtcgtgctgatgccacctgaacagctgctccag
gatgctcgcagcttcttgcgggcactgggcgccctgctccacaccaacctgcgcattaaa
cgggacgcccagggagccctcatggtatacccatattatggagagaagtcagctgccatg
aagaagcagaggatgacacgcaggtcccttcctgttgaagaagagcaggaggtggctggc
tctaaaatatttctggaaattgacaaccgccaatgtgttcaggattcagaccagtgcttc
aagaacaccgatgcagcagcagctcttctggcttctcacgccatccaggggaccctgtca
taccctcttgtgtctgtcatcagtgaatcctggactccaaaaagcactcagctcctctat
ctacttgctgttgctgttgtcattatcctgtttattatcctgctgggggtaatcatggca
aaacgaaagcgtaagcatggctccctctggctgcctgaaggtttcacccttcgccgagac
tccagcaatcacaagcgtcgtgagccggtgggacaggatgctgtggggctgaaaaatctg
tcagtgcaagtttcagaggctaacctaattggttctggaacaagtgagcattgggtcgat
gctgaaggaccccagcccaagaaggccaagggtgaagatgaggccttactctcagaagag
gatgaccccattgaccgacgcccatggacgcagcagcacctggaagctgcagacatccgt
aggacaccatcgtttgcacccactcctcctcaggcagagcaggaggtggatgtgctggac
gtgaatgtccgtggaccagatgggtgcaccccgctgatgctggcatctctccgaggaggc
agctcagacatgagtgatgaagatgaagaagcagaggactcctctgccaacatcatcaca
gacttggtgggccagggtgccagtctccaggcccagacagaccgcacaggcgagatggcc
ctgcacctcgcagcccgctactcgagagcagatgctgccaagcatctcctggatgcaggt
gcagatgccaatgctcaagacaacatgggccgctgccctctccacgccgcggtggcagcc
gatgcccagggtgtcttccagattctgatccgcaaccgagcaactgacctagatgccagg
atgaatgatggtactacgcccctgatcctggctgcccgcctggctgtggagggcatggtg
gcagagctgatcaactgccaagcagatgtgaatgcagtggatgaccacggaaaatctgct
cttcactgggcagctgctgtcaataatgtggaggcaaccattttgctgttgaaaaatgga
gccaaccgagacatgcaggacaacaaggaagagacacccctatttcttgctgcccgggag
gggagctatgaagcagctaagatcctgttagaccattttgccaaccgggacatcacagac
cacatggatcgcctcccccgggatgtggctcgggaccgcatgcatcatgacattgtgcgc
ctcctggatgagtacaatgtgacaccgagccctccaggcaccgtgctgacttctgctctc
tcacctgtcatctgtggacccaacaggtctttcctcagcctgaagcacactcctatgggc
aagaagcccagaaggcccaatgccaagagtgccatgcccactagcctccctcacctggcc
aaggaggccaaggatgccaagggtaacaggaggaagaagtctctgagtgacaagggccag
ctgtctgagagctcagtgaccttatcacccgttgattccctggagtctcctcacacatat
gtttctgacaccacatcctctccaatgattacatcccctggaatcttacaggcctcacca
cccaaccctatgttggccactgctgccccacctgcccctgcccactcacagcatgcattg
tctttctctaaccttcatgaaatgcagcctctggctcatggggccagcactgtgcttccc
tcagtgagccagttgctgtcccaccaccacattgtccctccaggaggtggcagtgcaggg
agcttgggtaggctacatccagtcactgtcccagcggactggatgaaccgcatggagatg
aatgaaacccagtacagtgagatgtttggtatggtcctcactccagctgagggcacccac
cctggcatagctccccagaacagaccacctgatgggaagcacataacccctcgggagccg
ttgccccccattgtgactttccagctgattcccaaaggcagcattgcccaaccagctggg
gcccctcagcctcagtccaactgtcctcccactgttgcaggccccctgcccaccatgtac
cagattccagaaatggcccgtttgccaaatgtggctttccctactgccatgatgccccag
caggatggtcaggtagctcagaccattctcccagcctatcatcctttcccagcctctgtg
ggtaagtaccccacgcccccttcacagcacagttatgcctcttcaaatgctgctgagcgg
acgcccagccacagtggtcacctccaaggtgagcatccctacctgacaccatccccagag
tctcctgaccagtggtcaagctcatcaccccactctgcttctgactggtcagatgtcacc
accagtcctacccctgggggagctggaggaggccagcggggacctgggacacacatgtct
gagccaccgcatagcaatatgcaggtctatgcgtga

DBGET integrated database retrieval system