KEGG   Loxodonta africana (African savanna elephant): 100656374
Entry
100656374         CDS       T04351                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04062  Chemokine signaling pathway
lav04217  Necroptosis
lav04380  Osteoclast differentiation
lav04621  NOD-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100656374 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100656374 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100656374 (STAT2)
   04625 C-type lectin receptor signaling pathway
    100656374 (STAT2)
   04062 Chemokine signaling pathway
    100656374 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100656374 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100656374 (STAT2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100656374 (STAT2)
   05160 Hepatitis C
    100656374 (STAT2)
   05171 Coronavirus disease - COVID-19
    100656374 (STAT2)
   05164 Influenza A
    100656374 (STAT2)
   05162 Measles
    100656374 (STAT2)
   05168 Herpes simplex virus 1 infection
    100656374 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100656374 (STAT2)
   05169 Epstein-Barr virus infection
    100656374 (STAT2)
   05165 Human papillomavirus infection
    100656374 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100656374 (STAT2)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100656374 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT2_C SH2
Other DBs
NCBI-GeneID: 100656374
NCBI-ProteinID: XP_010596330
LinkDB
Position
Unknown
AA seq 856 aa
MAQWEMLQNLDSPFQEQLHQLYSDSPLPVDVRQYLAVWIEDQNWREAALGNDDSKANVLF
HHFLGQLDDKCSPYNEDPECLLLQHNMRKFARDIQAFPKGPTQLAEMIFNLLLEEERILI
QAQRAQSVDQSEPALNAPVESQQHEIESRILELRAMMEKLVRSISQLKDQQDVFCFRYKT
QTPVRTPSLDPHQARQQQLLQETINELDKRRKEVLDASKALLGRLTTLIELLLPQLEEWK
VRQQKACIGAPLDHELKQLEKWFTDGAKLLFHLRQQLKELKGLSRMVSYSKDPLTKGVDL
REAQVTELLQRLLQSAFVVETQPCMPQTPHRPLIIKTGNKFSIQARLLVRLQEGNESLTV
EVSIDRNSPQIQGFRKFNLLTSNQKTLTPEKGQRQGLIWDFGFLTLVEQRSGGSGKGSNK
GLLSVTEELHIISFTLKYTYQGLKQELKTDTLPVVVISNMNQLSIAWASVLWFNLLSKNP
QNQQFFSSPPMAPWSLLGPALSWQFSSYIGRGLKPEQLSMLRDKLFGQNSTPESALSWAD
FTKRESPPGKLPFWTWLDKILDLVHDHLKDLWNDDCIMGFVSRSQERRLLKRTTSGTFLL
RFSETSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSVPLTEIIHHYQLLTEENIPENP
LRFLYPRTPRDEAFGRYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLEPKLEPGQES
LDLGLLLEPEPEPEPELSLELGSLLDAGLDLGPVLEPVLEPTPPMIPQTVPESKLEPELE
SILEPISEPVPEPDLPHDLRHLNIEEMEIFRNSSMKLEEILPNGDPPLPAPSTMDDVYVS
CPSHFHTDGRWSPCDF
NT seq 2571 nt   +upstreamnt  +downstreamnt
atggcgcagtgggagatgctgcagaatctcgatagcccatttcaggagcagctacaccag
ctctactcagatagccccctgccggtggatgttcgacagtacctggccgtctggattgaa
gatcagaactggcgggaggctgcactgggcaatgatgattccaaggctaacgtgctcttc
caccacttcttgggccaactggacgataaatgtagcccctacaatgaggaccctgagtgc
ttgttgctacagcacaatatgcgaaaattcgctcgggacatccaggcatttcccaagggt
cctacccagttggccgagatgatctttaatctccttctggaagaagaaagaattctgatc
caggctcagagggctcagtcagtggaccaaagtgagccagccctcaatgcacctgtggag
agccagcagcatgaaattgaatcccggatcctggaattaagggctatgatggagaagctg
gtgaggtccatcagccaactgaaagaccagcaggatgtcttttgcttccgatataaaacc
cagaccccagtgaggacaccctctttggacccccatcaggccagacagcagcagcttctg
caggaaactatcaatgaactggacaaaaggaggaaggaggtgcttgatgcctccaaagcc
ctgctgggccgattaactaccctaatcgagctactgctgccacagttggaggagtggaaa
gtccgacagcaaaaagcctgcattggggcccctctggaccatgagttgaaacagctggag
aagtggtttacagatggagcaaagttgttgtttcatttgcggcagcaattgaaggagctg
aagggattgagtcgcatggttagctattccaaggaccctctgaccaaaggggtagacttg
cgggaagcccaggtcacagagttgctacagcgtctgcttcaaagtgcctttgtggtagaa
acccagccctgcatgccccaaactcctcatcgacccctcatcatcaagactgggaataag
ttcagcatccaagcaaggctgctggtgagactccaggaaggtaatgagtcactgactgtg
gaagtctccattgataggaattcccctcaaatacaaggcttccggaagtttaaccttctg
acttcaaaccagaaaactttgactcctgagaaggggcagaggcagggcttaatttgggac
ttcggattcttgactctggtggaacaacgttcaggtggttcaggaaagggcagcaataag
gggctgctgagtgtgacagaggaactgcatatcatcagcttcacgctcaaatacacctac
cagggtctgaagcaggagctgaaaacggacaccctccctgtggtggttatttctaacatg
aaccaactctctattgcctgggcctccgttctctggttcaatctgctcagcaaaaacccc
cagaaccagcagttcttctcaagcccccccatggccccctggagcttgctgggccctgct
cttagttggcagttctcttcgtacattggccgaggcctcaaaccagagcaactgagcatg
ctgagggacaaattatttgggcagaactctaccccggagagtgcattgtcctgggctgac
ttcactaagcgagaaagccctcctggcaagctaccattttggacatggctggacaaaatt
ctggacttggtacatgaccatctgaaggatctctggaatgatgactgcatcatgggcttt
gtgagccggagccaggagcgccggctgctgaagaggaccacctctggcactttcctactg
cgattcagtgaaacatcagaaggaggcattacctgctcctgggtggagcaccaggatgat
gataaggtgctgatctactctgtgcagccctacaccaaggaggtgctgcagtcagtcccg
ctgactgaaatcatccaccactaccagctgctcactgaggagaacatacctgagaaccca
ctgcgcttcctttacccccgaaccccccgggatgaggctttcgggcgctactaccaggag
aaagtcaatctccaggaacggaggaaatacttgaaacacaggctcattgtggtttctaac
agacaggtggatgagctgcaacaaccgctggaacctaagctggagccagggcaggagtca
ttagacctggggctgttactagagccagagccagagcccgagcccgagctaagcctggag
ttggggtcactgctggacgcaggactggatctggggccagtgctggagcctgtgctggag
cccacaccacccatgataccacaaacagtgccagagtcaaagctggagccagagctggag
tccattctagagcccatatcagagccagtgccagagccagatttgccccatgatctgaga
cacttgaacattgaggaaatggaaatcttcagaaactcttctatgaagcttgaagaaatc
ctgccaaatggtgacccaccattgcctgccccgagcaccatggatgatgtctacgtctcc
tgccccagccatttccacacggatggacgctggagtccttgtgacttctag

DBGET integrated database retrieval system