KEGG   Loxodonta africana (African savanna elephant): 100656398
Entry
100656398         CDS       T04351                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04060  Cytokine-cytokine receptor interaction
lav04061  Viral protein interaction with cytokine and cytokine receptor
lav04151  PI3K-Akt signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04672  Intestinal immune network for IgA production
lav04940  Type I diabetes mellitus
lav05135  Yersinia infection
lav05142  Chagas disease
lav05162  Measles
lav05166  Human T-cell leukemia virus 1 infection
lav05200  Pathways in cancer
lav05320  Autoimmune thyroid disease
lav05321  Inflammatory bowel disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100656398 (IL2)
   04151 PI3K-Akt signaling pathway
    100656398 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100656398 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100656398 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100656398 (IL2)
   04660 T cell receptor signaling pathway
    100656398 (IL2)
   04658 Th1 and Th2 cell differentiation
    100656398 (IL2)
   04659 Th17 cell differentiation
    100656398 (IL2)
   04672 Intestinal immune network for IgA production
    100656398 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100656398 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100656398 (IL2)
   05321 Inflammatory bowel disease
    100656398 (IL2)
   05330 Allograft rejection
    100656398 (IL2)
   05332 Graft-versus-host disease
    100656398 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100656398 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100656398 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100656398 (IL2)
   05162 Measles
    100656398 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100656398 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lav04052]
    100656398 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100656398 (IL2)
Cytokines and growth factors [BR:lav04052]
 Cytokines
  Interleukins
   100656398 (IL2)
Glycosaminoglycan binding proteins [BR:lav00536]
 Heparan sulfate / Haparin
  Cytokines
   100656398 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 100656398
NCBI-ProteinID: XP_003410557
UniProt: G3SU90
LinkDB
Position
Unknown
AA seq 150 aa
MFKMQLLSCIALTLALVANSAPTSSSTKETQQQLEQLLLDLQMLLIRVKNYETRRLSMIF
TFKFNMPKEVTELKHLQCLVDELKPLEDVLNVAPSKQNTRELISNINVTALELQGSETTF
MCEYDDHAATIEEFLNKWIVFCQSIISTLI
NT seq 453 nt   +upstreamnt  +downstreamnt
atgttcaagatgcagctcttgtcttgcattgcactaactcttgcacttgtcgcaaacagt
gcacctacttcaagctcgacaaaggaaacgcagcaacagctggagcaattgctgctggac
ttacagatgcttttgattagagttaaaaattacgagactcgcagactctccatgatattc
acatttaaatttaacatgcctaaggaggtcacagaactgaaacatcttcagtgtctagta
gacgaactcaaacctctggaggacgtgctaaatgtagctccaagcaaacaaaacaccagg
gaattaatcagcaatatcaatgtaacagctctggagctacagggatctgaaacaacattc
atgtgtgaatatgatgatcacgcagcaaccattgaagaatttctgaacaaatggattgtg
ttctgtcaaagcatcatctcaacactgatttga

DBGET integrated database retrieval system