KEGG   Loxodonta africana (African savanna elephant): 100656405
Entry
100656405         CDS       T04351                                 

Gene name
MYLK2
Definition
(RefSeq) LOW QUALITY PROTEIN: myosin light chain kinase 2, skeletal/cardiac muscle
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04371  Apelin signaling pathway
lav04510  Focal adhesion
lav04611  Platelet activation
lav04810  Regulation of actin cytoskeleton
lav04921  Oxytocin signaling pathway
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100656405 (MYLK2)
   04020 Calcium signaling pathway
    100656405 (MYLK2)
   04022 cGMP-PKG signaling pathway
    100656405 (MYLK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100656405 (MYLK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100656405 (MYLK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100656405 (MYLK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100656405 (MYLK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100656405 (MYLK2)
  09154 Digestive system
   04971 Gastric acid secretion
    100656405 (MYLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100656405 (MYLK2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100656405 (MYLK2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100656405 (MYLK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 100656405
NCBI-ProteinID: XP_003411686
LinkDB
Position
Unknown
AA seq 606 aa
MATENGAVKLGIQSPSTDKAPKSAADKGPPAAEKEPGPPDPKKNPSSPDPEKEPDPPNLK
KDDKATTSEKGDGALVQPSTSSQDPEGEWGLGGGPAEGSAGQLADLPQPTATTETSAKKP
MAEQGTSGSQDPGEPKVAKKAAENLASVRRGSPAFLHSPSCPASISSPEKLLAEKPPSEE
LDLVFEGVPVSPGPVDPGPAKVAEGGKNTPEGSQKEAGEKAPGQAGQAKVQEDTPSGIEF
QAVPSQRSEVGQALCLTPREEDCFEILDDCPPPPAPFPHRIVKLRTGNVNSEFSINSKDA
LGGGKFGAVCTCTEKSTGLKLAAKVIKKQTPKDKEMVMLEIEVMNQLNHRNLIQLYAAIE
TPHEIVLFMEYIEGGELFERIVDEDYQLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPR
EYPVCHTTGHLVKIIDFGLARRYNPKEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGV
ITYMLLSGLSPFLGDDDTETLNNVLSANWYFDEETFEAVSDEAKDFVSNLIVKDQRARMS
AAQCLAHPWLNNLAEKAKRCNRLLKSQILLKKYLMKRRWKKNFIAVSAANRFKKISSSGA
LMSLGV
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggcgacggaaaacggagcagtcaagctgggaatccagagcccgtcaacagacaaggca
cccaaaagtgcagcagacaagggacccccggctgcagagaaagagcctggacccccagac
ccaaagaagaatcctagctccccagacccagagaaagaacctgatccacccaacctgaag
aaagatgacaaagccaccacctcagagaaaggggatggtgccctggtccagccctcaact
agcagccaggaccctgagggagagtggggcctgggcggggggcctgctgagggcagtgct
gggcagctggcagatctgccccagccaactgcaaccactgagaccagcgccaagaagccc
atggctgagcaggggacctccggcagccaggaccctggagagcccaaggtggccaagaag
gcagcagagaacctggcctcagtcaggaggggctcacccgccttcctgcacagccccagc
tgccctgccagcatctccagccctgagaagctcctggctgagaagcccccaagtgaggaa
ttggaccttgtctttgaaggggtgcccgtgagtcctggccccgtggatccggggccagcc
aaagtggcagaaggagggaagaacaccccggaagggagccagaaggaagcaggagagaaa
gccccaggccaggctggccaggctaaagtgcaagaggatactccaagtgggatagagttc
caggctgttccctcgcagagatcggaggtggggcaggccctctgcctcacacccagggag
gaggactgcttcgagattttagatgattgcccgccaccccccgcccccttcccccaccgc
atcgtgaagctgaggactggaaacgtcaacagtgaattcagcatcaactccaaggatgct
ctgggaggcggcaagtttggagcggtgtgcacttgcacagaaaaatccactggcctcaag
ctggcagccaaggtcatcaagaaacagacccccaaagacaaggaaatggtgatgctagag
attgaggttatgaaccagctcaaccaccgcaacctgatccagctctacgcagccattgag
accccgcacgagatcgtcctgttcatggagtacatcgagggcggcgagctcttcgagagg
attgtggatgaggactaccagctgacggaggtggacaccatggtgttcgtgaggcagatc
tgtgacgggatcctcttcatgcacaagatgagggttctgcacctggacctcaagccaaga
gaatatcctgtgtgtcacaccactggccatttggtgaagatcattgacttcggtctggca
cggaggtacaaccccaaagagaagctgaaggtgaattttgggaccccagagttcctgtca
cctgaggtggtgaattacgaccaaatctccgataagacagacatgtggagtatgggggtc
atcacctacatgctgctgagtggcctctccccgttcctgggagacgatgacacagagacc
ctaaacaacgttctgtctgccaactggtactttgatgaggagacctttgaggccgtgtca
gatgaggccaaagactttgtgtccaatctcatcgtcaaggaccagagggcccggatgagc
gctgcccagtgcctcgcccacccctggctcaacaacctggcagagaaagcaaagcgctgt
aaccgactcctcaagtcccagatcttgcttaagaaatacctcatgaagaggcgctggaag
aaaaacttcattgccgtcagcgctgccaaccgctttaagaagatcagcagctccggggca
ctgatgtctctaggggtctga

KEGG   Loxodonta africana (African savanna elephant): 100665634
Entry
100665634         CDS       T04351                                 

Gene name
MYLK4
Definition
(RefSeq) myosin light chain kinase family member 4
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04371  Apelin signaling pathway
lav04510  Focal adhesion
lav04611  Platelet activation
lav04810  Regulation of actin cytoskeleton
lav04921  Oxytocin signaling pathway
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100665634 (MYLK4)
   04020 Calcium signaling pathway
    100665634 (MYLK4)
   04022 cGMP-PKG signaling pathway
    100665634 (MYLK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100665634 (MYLK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100665634 (MYLK4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100665634 (MYLK4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100665634 (MYLK4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100665634 (MYLK4)
  09154 Digestive system
   04971 Gastric acid secretion
    100665634 (MYLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100665634 (MYLK4)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100665634 (MYLK4)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100665634 (MYLK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like Choline_kinase YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 100665634
NCBI-ProteinID: XP_010595880
LinkDB
Position
Unknown
AA seq 420 aa
MWMLYPLELSAVSRCLSGLQKLKHKLSKCFRKISDSPTGYAQSVSLQNGALKSHDCIMIY
RSESEADGNHTPDSTLTELPTTVLTVNRLEEINTCYSSTRLGEMAFFQCMEKVEKVKRYL
EENSYEQDSRSGKDEAKEKVWSHSSLKDTAPVTSKRTSALTEDVPAPPAPFDHRIVAVKQ
AAVNSFYTVSRTEILGGGRFGRVYKCEEKATGLKLAIKIIKTRGTKNKDEVRNEVSVMNQ
LDHVNLIQLYDALESKNDMVLVMEYVDGGELFDRIIDENCNLTELDTILFIRQICEGVRH
MHQMYILHLDLKPENILCVNRDTKQIKIIDFGLARRYKPREKLRVNFGTPEFLAPEVVNY
DFVSFPTDMWSVGVIAYMLWRISASEALKHPWLSEHKLHSRLRAQKKKNCYSDAQNHGTK
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtggatgctgtacccactggagctatcagcagtcagcaggtgcctttcaggattgcaa
aagctaaaacataagttgtctaaatgctttcggaagatctctgacagcccaactggatat
gctcaaagtgtaagcctacaaaatggggcactgaaaagtcatgattgcatcatgatttac
agatcggagtctgaggcagacggaaaccacactccagacagtaccctaaccgagctgccc
accactgtgctaacggtcaacaggctggaggaaatcaacacctgctacagcagcacccgg
ctgggggaaatggccttttttcagtgtatggaaaaggtagagaaagtgaaacgttatttg
gaagaaaattcttatgaacaggattcaaggtccggaaaggatgaggctaaagaaaaggta
tggtcgcactccagcctgaaggacacagcacctgtcacaagcaaaaggacctcagccctc
acagaggatgtcccagctcctcctgccccatttgatcatcgaattgtggcagtcaaacaa
gcagcagtcaacagtttttacaccgtgagcaggacagaaattttgggaggggggcgcttt
ggccgggtttacaagtgtgaagagaaagccacaggtctgaaactggcaatcaaaatcatt
aagaccagaggcaccaagaataaggatgaagtgaggaatgaagtcagcgtcatgaaccag
ctggaccacgtaaatctcattcagctctatgatgccttggagtctaagaacgacatggtc
ctggtcatggagtacgtggatggaggggagctgttcgaccgaatcattgatgaaaactgc
aatctcacagagctcgataccatcctgttcatcaggcagatctgcgagggcgtcaggcac
atgcaccagatgtacatcctccatttggacctgaagcctgagaatatcctgtgtgtgaat
cgggatactaaacaaataaaaattattgattttggattggccagaagatataagcccaga
gagaagctgagggtgaactttggcaccccggaattccttgcccctgaagttgtgaactat
gactttgtctccttcccgacggacatgtggagcgtaggagtcatcgcctacatgctctgg
aggataagtgcaagtgaagctctgaagcacccttggttgtcagaacacaagctgcactcc
agactcagagcacagaagaagaagaattgctactctgatgcccagaatcatgggaccaaa
tag

KEGG   Loxodonta africana (African savanna elephant): 100677183
Entry
100677183         CDS       T04351                                 

Gene name
MYLK
Definition
(RefSeq) myosin light chain kinase, smooth muscle isoform X2
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04270  Vascular smooth muscle contraction
lav04371  Apelin signaling pathway
lav04510  Focal adhesion
lav04611  Platelet activation
lav04810  Regulation of actin cytoskeleton
lav04921  Oxytocin signaling pathway
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100677183 (MYLK)
   04020 Calcium signaling pathway
    100677183 (MYLK)
   04022 cGMP-PKG signaling pathway
    100677183 (MYLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100677183 (MYLK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100677183 (MYLK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100677183 (MYLK)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100677183 (MYLK)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100677183 (MYLK)
  09154 Digestive system
   04971 Gastric acid secretion
    100677183 (MYLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100677183 (MYLK)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     100677183 (MYLK)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100677183 (MYLK)
SSDB
Motif
Pfam: I-set Ig_3 ig Pkinase Ig_2 23ISL PK_Tyr_Ser-Thr V-set C2-set_2 fn3 Ig_C17orf99 Ig_6 Ig_4 BiPBP_C Kinase-like Kdo DUF4573 AvrM_N
Other DBs
NCBI-GeneID: 100677183
NCBI-ProteinID: XP_010591208
LinkDB
Position
Unknown
AA seq 1974 aa
MLSMSAPGTRNEDPRPGVEGGFMKKHGQPVVSKTLGFTVPAVETRPSIWGECPPKFATKL
GRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSSRVSMSEKNGMQVLEIQEVDQDD
VGVYTCMVANGSGKASMSAELSIQGLDNTNRSFVRGTQAANTNIRREVTNGIAKGPKLDS
LETAAGSKNCSSAQRDVSATCVTDSQPQPLRESKLEPIRDLPRKALRTPVLQKTSSTITL
QAAKAQPEQQAPASGALCPSREERKRPAAPPPATLHARQPDLQSQEGVSKVAVRKIAMES
WRDSTVPKFESKPQSQEVSEDETVKFRCEVSGVPKPEVTWFLEGVPVRQREGIVEVYEAA
GSHYLCLLKARTRDSGNYSCTASNVRGQVSYSWALQVKKLAMAGVAPSFSSVLKDCSVIE
GQDFVLQCSVQGTPEPQITWLLNEQPIQYAHSSCEAGRAELHVQDALPEDHGTYTCLAEN
TLGQASCSARVTVHEKKSDRKSEYLLPVAPSKPIAPIFLQGLSDLEVMDGSQVTMTVQVS
GNPPPEVIWLHNGQEIQESEDFHFEQQGARHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQ
AVLTVQEPHDGTQPWFISKPRSVTATLGQSVLISCAIAGDPFPTVHWLRDGKTLSKDSGD
FEVLQNEDVFTLVLKNVQPWHAGQYEILLRNRVGECTCQVSLMLQTSPAGAPSRGREPAG
CEGLCGGRVGADGGGGDRYGTLRPDWPARGQGWPEEEDGEDVRGVLKRRVETRQHTEEAI
RQQEVEQLDFRDLLGKKVSTRTLSENDLKETPAEQMDFRANLQRQVKPKTVSEEERKVHS
PQQVDFRSVLAKKGTSKTPVPENVPPPKPTTPDFRSVLGSKKKLPAENGSSGAEALNAKG
VESPKPVGSAHSESLKPTGNAKPAETLKPLGNAKPAETLKPLGNAKPAETLKPFGNIKPA
ETLRPVGNAKPAETLRPIGNAKPAEALRSVGSAKPAEALRPVGNGKPTEALKPLGNAKPA
ETTKPLGNAKPAETTKPLGNAKPAEIPKPLGNAKPAEIPKPLGNAKPAEIPKPLGNAKPA
ETPKLLGNAKPAETPKPLGNAKPAETLKPLGNTKPAEAPIPAGKEELKKEVKNDVNFRKG
HAGTPDNEKRSESQGIAPAFKEKLQDVRVAEGKKLLLQCLVSSDPPATITWTLNGKTLKT
TRFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNSAGQAECSCQVIVDDAPTSENAKAPE
MKSRRPKSSFSTVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKKIQESEHIKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ
AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSVEIWDSVDKMWKE
LATCRSTSFNVQDLLPDREYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVAVNTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTGKIWAGKFFKAYSA
KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMKQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARKLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDF
DDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEDVSQAFLEAVA
EEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDE
DGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEEE
NT seq 5925 nt   +upstreamnt  +downstreamnt
atgttgtccatgtctgctcccgggaccagaaatgaagaccccagaccaggagtagaaggg
gggtttatgaagaagcatggccagcctgttgtttccaaaaccttggggtttacagtccct
gcagtggagacccgtcctagcatctggggagagtgcccaccaaagtttgctaccaagctg
ggccgagtggtggtcaaagaaggacaaatgggacgattctcctgcaaaatcactggccgg
ccccaaccacaggtcacctggctcaagggaaacgttcctctgcagccgagttcccgtgtg
tccatgtctgagaagaatgggatgcaagttctggaaatccaggaagtcgaccaagatgat
gtgggagtgtacacgtgcatggtggcgaatgggtccgggaaggcctccatgtctgctgag
ctttctatccaaggtttggacaacaccaacaggtcatttgtgagaggcacacaggctgcc
aatacaaacatcaggagggaggtgaccaatggaatcgccaaggggccaaaactggatagc
ctggagactgcagctggaagtaagaactgctccagtgcccagagagatgtctcagccacc
tgtgtcaccgatagccagcctcagcccctgagggaatccaagctggagccgattagggac
ttacccagaaaggccctgaggactcccgtccttcagaagacttccagcaccatcaccctg
caggctgcaaaagcacagcctgagcagcaagcaccagcctcgggggccctctgtccctcc
agagaagagaggaagaggccagccgcgcctcctccagccaccctccatgcaaggcagcct
gacctccaaagccaagaaggtgtgagcaaggttgctgtcaggaaaatcgccatggagagc
tggagggattcaacagtccccaaatttgagagcaagccccaaagccaggaagtcagtgag
gacgaaacagtcaagttcagatgtgaggtttcaggggttccaaagcctgaagtgacctgg
ttcctggaaggtgtccctgtgaggcaacgagaaggcattgtggaggtttatgaagctgct
ggatcccattacctgtgcctgctgaaagcccgcacgagggacagtggaaactacagctgc
acagcttccaatgtccgaggccaggtgtcctatagctgggccctccaggtgaaaaagttg
gccatggcgggagtggccccctccttctccagtgtcctgaaggactgctccgtcatcgaa
ggccaggactttgtgctgcagtgctctgtgcagggaaccccggagccccaaatcacttgg
ctgctcaatgaacagcccatccagtatgctcactccagctgcgaggccggcagggctgag
ctccacgtccaggatgcccttccggaggaccatggtacctacacctgtctagcggagaac
accttggggcaggcgtcctgcagcgcccgggtcaccgtccatgaaaagaagagtgacagg
aagagtgagtaccttctacccgtggctcccagcaagcccatcgcacccatcttcctgcag
ggcctctctgatctcgaagtcatggatggaagccaggtcaccatgacagtccaggtgtca
gggaacccaccccctgaggtcatctggcttcacaatgggcaggagatccaggagtcagag
gacttccactttgaacagcagggtgctcgccacagcctttgtatccaggaggtgttccca
gaggacacgggcacgtacacctgtgaggcctggaacagcgctggagaggtccgcacgcag
gccgtgctcacggtgcaagagcctcacgatggcacccagccctggttcatcagcaagcct
cgctctgtgacagccaccctgggccagagcgtcctcatatcctgcgccattgctggcgac
ccctttcccaccgtgcactggctccgagatggcaaaaccctctccaaagacagtggtgac
tttgaggttctgcagaacgaggatgtgtttaccctggttctaaagaacgtgcagccctgg
cacgccggccagtatgagatcctgctcagaaaccgggttggcgaatgcacttgccaggtg
tcgctgatgctgcagaccagccctgccggagccccttcacgggggagggagcctgccggc
tgtgagggcctctgtggtggacgagttggtgctgatggtggtggtggtgaccgctatggg
accctgaggcccgactggccagcgagagggcagggttggccagaggaggaagacggtgag
gacgtgaggggggtgctgaagaggcgcgtggagacacggcagcacaccgaggaggcaatt
cgccagcaggaggtggagcagctggacttccgtgacctcctggggaagaaggtgagtacc
aggaccctgtcagaaaacgacctgaaggagaccccggctgagcagatggatttccgcgcc
aacctgcagcggcaagtgaagccaaagactgtgtctgaggaagagaggaaggtgcatagc
ccccagcaggtggacttccgctcggtcctggccaagaaggggacatccaagaccccagtg
cctgagaacgtgccacctcccaaacctaccaccccagatttccgttcggtgctgggcagc
aagaagaaattaccagcagagaatggtagcagcggtgctgaagccttgaacgccaaggga
gtggagagccctaagccagtaggcagtgcacattcagagtccctaaaacccacgggcaat
gccaagccagctgagaccctgaaacccttgggcaatgccaagccagccgagaccctgaaa
cccttgggcaatgccaagccagccgagacccttaaaccttttggcaacatcaagccagct
gagaccctgagacctgttggcaatgccaagccagccgagaccctgagacctattggcaac
gccaagccagccgaggccctgagatctgttggcagtgccaagccagccgaggccctgaga
cctgttggcaatggcaagccaactgaggccctgaaacccctgggcaatgccaagccagcc
gagaccacaaaacccctgggcaacgccaagccagccgagaccacaaaacccctgggcaac
gccaagccagctgagatcccaaaacccttgggcaatgccaagccagctgagatcccaaaa
cccctgggcaatgccaagccagctgagatcccgaaacccctgggcaatgccaagcctgct
gagaccccaaaactcctgggcaatgctaagccagctgagaccccaaaacccctaggtaat
gccaagccagctgagacactgaagcccctgggcaacaccaagccagctgaggccccaata
ccagctggaaaagaagaactcaagaaggaggttaagaatgatgtgaacttcaggaaaggg
catgcaggaaccccagataatgaaaaaagatcagaaagccaagggatagccccagccttc
aaggagaagctacaagatgtccgtgtggcagagggcaaaaagttgctactccagtgcctg
gtgtcctctgaccccccagccaccatcacctggacgctgaatggaaagacgctgaagacc
accagattcatcatcctctctcaagaaggctcactctgctccgtctccattgagaaggcc
ctgcccgaggacagaggcttgtacaagtgtgtagccaagaacagtgccggccaggctgag
tgttcctgccaagtcatcgtggacgatgctcccaccagtgagaatgccaaggccccggaa
atgaaatcccgtagacctaagagctctttttccaccgtgctaggaacagagagtgatgca
actgtgaaaaagaaacctgcccccaagacaccgccgaaggcagctatgccccctcagatc
atccagtttccagaggaccaaaaggtgcgtgctggtgagtctgtggagctgtttggcaaa
gtgacaggcacccagcccatcacctgtacctggatgaagtttcgaaagaagatccaggag
agtgagcacatcaaggtggagaacagcgagaatggcagcaagctcaccattctggccgca
cgccaggagcactgtggctgctacacactgctggtggagaacaagctgggcagccggcag
gcccaggtcaacctcacggtggtggataaaccagaccccccagccggcacgccttgcgcc
tctgatattcgaagctcctcattgaccctgtcctggtacggctcctcgtatgacgggggc
agtgccgtgcagtcctacagtgtcgagatctgggactcagtggacaagatgtggaaggaa
ctggccacatgccgcagcacttcttttaatgtccaggacctgctacctgaccgcgagtat
aaattccgtgtgcgcgcaatcaacgtgtatggaaccagtgagccgagccaggagtctgaa
ctcacaacggtgggagagaaacccgaggagccgaaggatgaagtggaggtgtcggatgat
gatgagaaggagcccgaggtggattatcggacagtggcagtcaataccgagcaaaaggtt
tctgacttctacgacatcgaggagagactaggatctgggaaatttggacaggtgtttcga
ctcgtagaaaagaaaactggaaaaatctgggcagggaaattcttcaaggcgtattcagca
aaggagaaggagaacatccggcaggagattagcatcatgaactgcctgcaccaccccaag
ctggtccagtgtgtggatgccttcgaagagaaggccaacatcgtcatggtcctggagatc
gtgtcggggggtgagctgtttgagcgcatcattgacgaggactttgagctgacggagcgc
gaatgcatcaagtacatgaagcagatctctgagggggtggagtacatccacaagcagggc
atcgtccacctggacctcaagcccgagaacatcatgtgtgtcaacaagacgggcaccagg
atcaagctcatcgacttcggtctggccagaaagctggagaatgcggggtctctgaaggtc
ctctttggtacccctgagtttgtggcccctgaagtgatcaactacgagcccattggctat
gccacggacatgtggagcatcggggtcatctgctatatcctggtcagtggactttccccc
ttcatgggtgacaatgataatgaaaccttagccaacgttacctcagccacctgggacttc
gacgatgaggcgttcgacgagatctctgatgatgccaaggatttcatcagcaatttgctg
aagaaagacatgaaaaaccgcctggactgtacccagtgccttcagcacccatggctaatg
aaagacaccaagaacatggaggccaagaagctctccaaagaccggatgaagaagtacatg
gcaagaaggaaatggcagaaaacaggcaatgctgtgagagccattggaagactgtcctct
atggctatgatctcagggctcagtggcaggaaatcctcgacaggctccccaaccagccca
ctcaatgcagagaaactagaatctgaagatgtctcgcaagctttccttgaggccgttgct
gaggaaaagccccatgtaaaaccctacttctctaagaccatccgtgatttagaagttgtg
gaaggaagtgctgctaggtttgactgcaagattgaagggtacccagaccctgaggtcgtc
tggttcaaagatgaccagtccatcagggagtcccgtcacttccagatagactatgatgag
gatgggaactgctctttaattattagtgatgtttgcggggatgacgacgccaagtacacc
tgcaaggctgtcaacagcctcggagaagccacctgtacagcagagctgattgtggagacc
atggaagaaggagaaggggaaggagaagaggaagaagaagagtga

DBGET integrated database retrieval system