KEGG   Loxodonta africana (African savanna elephant): 100656450
Entry
100656450         CDS       T04351                                 

Gene name
TAB2
Definition
(RefSeq) TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 isoform X2
  KO
K04404  TAK1-binding protein 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04064  NF-kappa B signaling pathway
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04668  TNF signaling pathway
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05145  Toxoplasmosis
lav05161  Hepatitis B
lav05162  Measles
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100656450 (TAB2)
   04064 NF-kappa B signaling pathway
    100656450 (TAB2)
   04668 TNF signaling pathway
    100656450 (TAB2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100656450 (TAB2)
   04621 NOD-like receptor signaling pathway
    100656450 (TAB2)
   04657 IL-17 signaling pathway
    100656450 (TAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100656450 (TAB2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100656450 (TAB2)
   05135 Yersinia infection
    100656450 (TAB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100656450 (TAB2)
   05161 Hepatitis B
    100656450 (TAB2)
   05171 Coronavirus disease - COVID-19
    100656450 (TAB2)
   05162 Measles
    100656450 (TAB2)
   05168 Herpes simplex virus 1 infection
    100656450 (TAB2)
   05169 Epstein-Barr virus infection
    100656450 (TAB2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100656450 (TAB2)
   05140 Leishmaniasis
    100656450 (TAB2)
SSDB
Motif
Pfam: CUE zf-RanBP DivIC
Other DBs
NCBI-GeneID: 100656450
NCBI-ProteinID: XP_010585039
UniProt: G3U8E1
LinkDB
Position
Unknown
AA seq 693 aa
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGISGLRNHMTSLNLDLQSQNVYHHGREGNRMNGSRTLTHSISDGQLQGGQSNNE
LFQQEPQTAPAQVPQGFNVFGMSSASGASNSAPHLGFHLGSKGTSNLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPSGTARQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTTYPTSNPLSHTSAQQPNQQGHQTSHVYMPISSPTTPQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNSSSKLRSSGPRTSSSSSSVNSQTL
NRNQPTVYIAASPPNTDEVMSRSQPKVYISANAAAGDEQGMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRAVGSNSAASPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLADPALAHVDRMSEARKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDPRSTIKTPKNQDT
EDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttgcatgacctgcgacaaaaattc
cctgaagtacctgaagttgttgtatccaggtgcatgttacagaataataataacctggat
gcctgctgtgcagttctctctcaggagagtacaaggtatctttatggtgaaggagacttg
aatttttcggatgattctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcagtcacagaacgtttaccaccatggaagagaaggaaatagaatgaatggaagt
aggactctaacgcacagcatcagtgatggacaacttcaaggtggtcagtccaataatgaa
ctctttcagcaggagccacagacagcaccagctcaagttcctcaaggttttaatgttttt
ggaatgtccagtgcatctggtgcttcaaattcagcaccacatcttggatttcacttaggc
agcaaaggaacatctaacctttctcaacagacccccagatttaatcccattatggtaact
ttagccccaaatatccagactggtcgtaacactcctacatctttgcacatacatggtgta
cctccacctgtacttaatagtccacagggaaattctatctatattaggccttacattaca
actcctagtggtacagctcggcagacacaacagcattctggctgggtatctcagtttaat
cccatgaaccctcaacaagtctatcaaccttcacaacctggtccctggactacttaccct
acgtctaatcctctgtcacatacctcagcccaacagccaaatcagcaaggccaccagacc
tctcacgtctacatgcccatcagttcacctactacgccacagccaccaacgattcattca
tctggtagctctcagtcttcagcccacagccaatacaacattcagaatatttcaacagga
cctcgaaaaaaccagattgaaatcaaacttgaacccccacaaagaaacagttcttcaaaa
ctgcgttcctctggacctcgaacctccagcagttcctcttcggtcaacagccagacctta
aatcgaaatcagcccactgtttacatagctgccagccccccaaataccgatgaggtgatg
tcccgtagtcagcccaaggtctatatttcagccaatgctgccgcaggagatgagcagggc
atgcggaatcagcccaccctcttcatatccacaaactctggagcatctgctgcctccagg
aatatgtctgggcaagtgagcatgggtcctgcctttattcatcaccaccctcccaaaagt
cgggcagtaggcagtaactctgcagcttctcctcgagtggtagttactcaacccaataca
aaatacactttcaaaattaccgtttctcccaataagccccctgcagtttcaccaggggtg
gtgtcccctacctttgaacttacaaatcttctaaaccatcctgatcattatgtagaaaca
gagaacattcagcacctcgcggaccctgctttagcacatgtggatagaatgagtgaagca
cggaaactgagtatgggatctgatgatgctgcctacacacaagctttattggtacaccag
aaggccaggatggaacgacttcaaagagagctggagattcaaaagaaaaagctggataaa
ctaaaatctgaggtcaatgaaatggaaaataatctaactcggaggcgcctgaaaagatcg
aattccatatcccagataccttcacttgaagaaatgcagcagttgagaagctgtaataga
caactgcaaattgacattgactgcctgaccaaagaaattgatctttttcaagcccgagga
ccacattttaatcccagcgccattcataacttttatgacaatattggatttgtaggtcct
gtgccaccaaaacccaaagatccacggtccaccatcaaaacaccaaagaatcaagacaca
gaagatgacgagggagcgcagtggaattgcactgcctgtacctttttgaaccatccagcc
ttaatccgttgtgaacagtgtgagatgccaaggcatttctga

DBGET integrated database retrieval system