KEGG   Loxodonta africana (African savanna elephant): 100656495
Entry
100656495         CDS       T04351                                 

Gene name
PTH1R
Definition
(RefSeq) parathyroid hormone/parathyroid hormone-related peptide receptor isoform X1
  KO
K04585  parathyroid hormone receptor 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04928  Parathyroid hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100656495 (PTH1R)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100656495 (PTH1R)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100656495 (PTH1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100656495 (PTH1R)
G protein-coupled receptors [BR:lav04030]
 Secretin receptor family
  Calcium-regulating peptide
   Parathyroid hormone
    100656495 (PTH1R)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 100656495
NCBI-ProteinID: XP_023403549
LinkDB
Position
Unknown
AA seq 681 aa
MTKEEQIFLLHRAQAQCEKRLKEVQLRPASIMESDKGWTSASTSGKPRKDKASGKLYPES
EEDQEVPSGSRPQGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRN
GSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAY
FRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGTALDEAERLTEKELRAIAQAPPPL
SAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLP
AIFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVVSRGGRLAMGWSGSVDYPLT
GTCRGFWSPGIEEPQGPVHMETLRAQEATQRCNGTAEPGAGLGVQVSLPQPARVQPQFSP
PHPHSSTSSSSSTSSGCLPPSCGRPMPAGVTRGSSTGSCSNPHWCSCRSSVSTTSSSWPR
RTPRSQGRSGKSRCTTRCSSTPSRCAAWAWPAQGGGVGGCCSHPYTQTWTPSPDPPVCLS
PQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVG
PRAGLGLPLSPRLLPAATTNGHPQLPSHTKPAAPALETTAPAMAAPKDNGLLNGSCSGLD
EEASGPERPPALLQEEWETVM
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgaccaaggaggaacagatcttcctgctgcaccgagcccaggcccagtgtgagaagcgg
ctcaaggaagtccaactgaggccagccagcataatggagtcagacaagggatggacctct
gcgtccacctcagggaagcccaggaaagacaaggcatctgggaagctctacccggagtcc
gaggaggaccaggaggtgcccagtggcagtaggccccaagggcgtccctgcctgcctgag
tgggaccacatcctgtgctggcctctgggggcaccaggtgaggtggtggctgtgccctgt
cctgactacatttatgacttcaatcacaaaggccatgcctaccgacgctgtgaccgcaat
ggcagctgggagctggtacctgggcacaacagaacatgggccaactacagcgagtgcgtc
aagttcctgaccaatgagactcgtgaacgggaggtgtttgaccgcctgggcatgatctac
actgtgggctactccgtgtcgctggcctccctcaccgtggcggtgctcatcctggcctac
tttaggaggctgcactgcacgcgcaactacatccacatgcacctgttcctgtccttcatg
ctgcgcgcagtgagcatcttcgtcaaggacgcggtgctctattcgggcaccgcgcttgac
gaggcggagcgcctcaccgagaaagagctgcgcgccatcgcccaggccccgccgccgctc
tctgccgctgccggctacgcgggctgccgggtggcggtgaccttctttctttacttcttg
gccaccaactactactggattctggtggaggggttgtacctgcacagtctcatcttcatg
gccttcttctcagagaagaagtacctatggggcttcacagtcttcggctggggtctgccc
gccatcttcgtggccgtgtgggtcagtgtgagagccaccctggccaacaccgggtgctgg
gacttgagctctgggaacaagaagtggatcatccaggtgcccattctggcctccattgtg
gtgagcaggggtgggaggctggccatggggtggagtgggagtgtggactaccccctgaca
gggacctgtagaggtttctggagcccaggaatagaagaaccacaagggcctgtccacatg
gagacactgagggcccaagaagccacacagagatgtaacggcacagcagagcctggggca
gggctgggggtccaagtgtccttgccccaacctgctagggtacagcctcagttcagcccc
cctcacccccacagctcaacttcatcctcttcatcaacatcgtccgggtgcttgccacca
agctgcgggagaccaatgccggccggtgtgacacgcggcagcagtaccggaagctgctca
aatccacactggtgctcatgccgctcttcggtgtccactacatcgtcttcatggccacgc
cgtacaccgaggtctcagggacgctctggcaaatccagatgcactacgagatgctcttca
actccttccaggtgcgcggcttgggcctggccggctcagggcggtggggtgggtggttgc
tgctcccacccctacacccagacctggactcccagccctgacccaccggtctgcctctct
ccacagggattttttgtcgccatcatatactgtttctgcaatggcgaggttcaggctgag
atcaagaagtcttggagccgctggacactggcattggacttcaagcggaaggcacgcagt
gggagcagcagttacagctatggcccgatggtgtcacacacgagtgtgaccaatgtaggc
ccccgcgcgggactcggcctgcccctcagcccccgccttctgcccgctgctaccaccaac
ggccacccccagctgcccagccacaccaagccagcggccccagctctggagaccacagca
cctgccatggccgctcccaaggacaatgggctcctcaatggctcctgctcagggctggac
gaggaggcctctggacctgagcggcctcccgccctgctgcaggaggaatgggagacagtc
atgtga

DBGET integrated database retrieval system