KEGG   Loxodonta africana (African savanna elephant): 100656524
Entry
100656524         CDS       T04351                                 

Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S-type
  KO
K00458  arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00590  Arachidonic acid metabolism
lav01100  Metabolic pathways
lav01523  Antifolate resistance
lav04726  Serotonergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100656524
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100656524
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100656524
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100656524
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     100656524
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 100656524
NCBI-ProteinID: XP_003416926
UniProt: G3SUT9
LinkDB
Position
Unknown
AA seq 664 aa
MGRYRIRVATGAWLFSGSRNRVQLWLVGARGAAELELQLRTARGEEEEFEHDIPDDLGPL
QFVKLRKHHSLVDDAWFCDRITVQGPGACAEAAFPCYRWVQGRGILSVPEGTGEGAGSQS
LDVFQKYREKELEERREIYRWASWREDYPLANKLQTARDDLPPNVRFHEEKRLDFECTLH
AGVLETTLKRVYTLLSSWNHLENFNQIFWGQKSMLAEKVHQCWQDDELFGYQFLNGANPM
LLRRSTSLPSRLVLPSGTEELQAQLEKELQNGSLFEADFILLDGIPANVIRGEQQYLAAP
LVMLKMEPNGKLLPMVIQLQPPNSSSSTPPLFLPSDPPLAWLLAKSWVRNADFQLHQLQY
HLLNTHLVAEVIAVATMRCLSELHPLFKLLAPHTRYTMEINTRARTQLISEGGIFDKAVS
TGGGGHVALLRRAGAQLTYCSLCVPDDLANRGLLGLPCALYAHDALRLWEIIARYVERIV
HLFYQRDDIVRGDPELQAWCWEITEVGLCQAQDRGFPVSFQSRAQLCHFLTMCVFTCTAQ
HSAINQGQLDWYAWVPNAPCTMRMPPPTTKEDITMATVMGSLPDVRQACLQMTITWHLGR
RQPDMVPLGHHKEKYFSSPEAKAVLNQFQTDLENLEKEIIARNEQLDLPYEYLKPSRIEN
SVTI
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgggccgctaccgcatccgcgtggccaccggagcctggctcttctccgggtcgcgcaac
cgcgtgcagctgtggctggtcggggcgcgcggggcggcggagctggagctgcagctgcgg
acggctcggggagaggaggaggagtttgagcacgacatccccgacgacttggggccactg
cagtttgtgaagctgcgcaagcaccactccctggtggacgacgcgtggttctgcgaccgc
atcaccgtgcagggccccggggcctgcgccgaggccgccttcccgtgctatcgctgggtg
cagggacggggcatcctgagcgtgcccgagggcaccggtgagggggcagggagccaatcc
cttgatgtgttccagaagtatcgagagaaagaactagaagaaagacgggagatctaccgc
tgggcctcctggagggaagattaccccctggccaataagctgcaaactgcaagggacgat
ctacctccaaatgtgagattccacgaggagaagagactggactttgaatgcacactgcac
gcaggggttctagagaccaccctcaagcgtgtttataccctcctgagctcctggaaccac
ctggagaatttcaatcagatcttctggggccagaagagcatgctggctgaaaaggttcac
cagtgctggcaggacgatgagctttttggctaccagttcctcaacggcgccaaccccatg
ctgttgagacgttccacatctctgccctcccggctagtgctgccctcagggacagaggag
cttcaggcccagctggagaaagaactccagaacggttccctgtttgaggctgactttatc
ctgctggacgggattccagccaatgtgatccgaggagagcagcagtacctagctgctccc
cttgtcatgctgaagatggaacccaatgggaagctgctacccatggtcattcagctccag
cctcccaactctagctcctccaccccaccactgttcctgccctcagatcctccacttgct
tggcttctggcaaagtcctgggtccgaaatgcagacttccaactgcaccagcttcaatat
catttgctgaacactcatctggtggctgaggtcatcgctgttgccactatgaggtgcctc
tcagaactgcaccctctcttcaagctcctggccccccacacccgatacactatggaaatc
aacacccgggcccggacccagctcatctcagaagggggtatatttgataaggctgtgagc
acaggaggagggggccatgtggccttgctccgtcgagcaggggcccagctgacctactgc
tccctctgtgttcctgacgacctggctaaccggggcctgctgggactcccctgtgctctc
tatgcccatgatgctttacggctctgggagatcattgcccggtacgtggagaggatcgtc
cacctcttctaccaaagggatgatatcgtgagaggggaccctgagctgcaggcctggtgt
tgggagatcactgaggtggggctgtgccaggcccaggaccgaggtttccctgtttccttc
cagtcccgggctcaactctgccatttccttaccatgtgtgtcttcacctgcactgcccag
cattcagccatcaaccaaggccagcttgactggtatgcctgggtccctaatgccccatgc
acaatgcggatgcccccacccaccaccaaggaagacataacaatggccacagtgatgggg
tcactacctgatgtccggcaggcctgtcttcaaatgaccatcacatggcatctgggtcgg
cggcagccagacatggtacctctggggcaccacaaagaaaaatatttctcaagccccgaa
gcgaaggctgtgctaaaccaattccaaacagatttggaaaacctggaaaaggagattata
gcccggaatgagcaacttgacctgccctatgaatacctgaagcccagccgcatagagaac
agtgtcactatctga

DBGET integrated database retrieval system