KEGG   Loxodonta africana (African savanna elephant): 100656573
Entry
100656573         CDS       T04351                                 

Gene name
PDE4D
Definition
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 4D isoform X2
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04024  cAMP signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100656573 (PDE4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100656573 (PDE4D)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100656573 (PDE4D)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100656573 (PDE4D)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100656573 (PDE4D)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 100656573
NCBI-ProteinID: XP_010586455
LinkDB
Position
Unknown
AA seq 688 aa
MAFVWDPLGATAPGPSPRAKTRLRFAKSYSFDVDNGTSSGRSPLDPMTSPGSGLILQANF
VHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNFAA
LTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSVSE
MASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQHEVEIPSPTQKEKEKKKRPMS
QISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTV
IMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPA
LEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKL
LQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLL
DNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDK
HNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPDD
QEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDE
QVEEEAVGEEEESQPEACVIEDHSSDDT
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggctttcgtttgggatcctttgggagccacagcgccaggaccatctccaagagccaaa
acaagattgcgttttgcaaagtcctacagtttcgatgtggacaatggcacatcttcggga
cggagtcccttggatcccatgaccagcccaggatctgggctaattctccaagcaaacttt
gtccacagtcaacgtcgggagtccttcctgtatcgatccgacagcgattatgacctctct
ccaaagtctatgtcccggaactcctccattgccagtgatatacatggagatgacttgatt
gtgaccccatttgctcaggtcttggccagcctgcgaactgtacgaaacaactttgctgca
ttaactaatttgcaagatcgagcacctagcaaaagatcacccatgtgcaaccaaccatcc
atcaacaaagccaccatcacagaggaggcctaccaaaaactggccagcgagaccctggag
gagctggactggtgtctggaccagctagagaccctgcagaccaggcactctgtcagtgaa
atggcctccaacaagtttaaaaggatgcttaatcgggagctcacccatctctctgaaatg
agtcggtctggaaatcaagtatcagaatatatatcaaacacatttttagataagcaacat
gaggtggaaattccttctccaactcagaaggaaaaggagaaaaagaaaaggccaatgtct
cagatcagtggagtcaagaagttgatgcacagctctagtttgactaattcgagtatcccg
aggtttggagttaaaactgaacaagaagatgtccttgccaaggaactagaagatgtgaac
aaatggggtcttcatgttttcagaatagcagagttgtctggtaaccggcctttgactgtt
atcatgcacaccatttttcaggaacgggatttgttaaaaacatttaaaattccagtagat
actttaattacataccttatgactcttgaagaccattaccatgctgatgtggcctatcac
aacaatatccacgcggcagacgtggtccagtccactcatgtgctattatcaacacctgct
ttggaggctgtgtttacagatttggaaattcttgcagcaatttttgccagtgcgatacat
gatgtggatcatcctggggtctccaatcagtttctgatcaatacaaactctgaacttgcc
ttgatgtacaatgattcctctgtcttggagaaccaccatttggccgtgggctttaagttg
ctccaggaagaaaactgtgacattttccagaatttgaccaaaaagcaaagacaatcatta
aggaaaatggtcattgacattgtacttgcgacagacatgtcaaaacacatgaatctactg
gctgacctgaaaactatggttgaaactaagaaagtgacaagctctggggttcttcttctt
gacaattattctgacaggattcaggtccttcagaatatggtgcattgtgcggatctgagc
aacccgacaaagccgctgcagctgtaccgccagtggacggaccggataatggaggagttt
ttccgccaaggggaccgtgagagggagcgcggcatggagatcagccccatgtgtgacaag
cacaacgcctctgtggaaaaatcacaggtgggcttcatagactatattgttcatcctctc
tgggagacctgggcagaccttgtccatcctgatgcccaggacattttggacactttggag
gacaatcgtgaatggtaccagagcacaatccctcagagtccctcacctgcccctgatgac
caagaagagggccgacagggtcagaccgagaaattccagtttgaactaactctagaggaa
gatggcgaatcagacacagagaaggatagtggaagtcaagtggaggaagacactagctgc
agtgactccaagactctctgtactcaagactcagagtccaccgaaatcccccttgatgaa
caggtcgaagaggaagcagtaggggaagaagaggaaagccagcccgaagcttgtgtaata
gaagatcattcttctgacgacacgtaa

KEGG   Loxodonta africana (African savanna elephant): 100667499
Entry
100667499         CDS       T04351                                 

Gene name
PDE4B
Definition
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 4B
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04024  cAMP signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100667499 (PDE4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100667499 (PDE4B)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100667499 (PDE4B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100667499 (PDE4B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100667499 (PDE4B)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR DFP
Other DBs
NCBI-GeneID: 100667499
NCBI-ProteinID: XP_023405265
LinkDB
Position
Unknown
AA seq 564 aa
MKEHCGTFSNAVISGVSGDSAMDSLQPLQPNYMSVCLFAEESYQKLAMETLEELDWCLDQ
LETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPT
QKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVSTENEDHLAKELEDLNKWGLNI
FNVAGYSHNRPLTCIMYAIFQERDLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAA
DVAQSTHVLLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDE
SVLENHHLAVGFKLLQEEHCDIFQNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTM
VETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDK
ERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWY
QSMIPQSPSPPLDERNRDCQGLMEKFQFELTLEEEDSEGHEKEGEGHNYFSSTKTLCVIH
PENRDSLEETDVEIATEDKSPIDT
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgaaggagcactgtggcaccttcagtaacgccgtgatcagcggagtcagcggtgactcg
gctatggacagtctgcagccgctccagcctaactacatgtctgtgtgtttgtttgcagaa
gaatcttatcaaaaattagcaatggaaacgctggaggaattagactggtgtctagatcag
ctagagaccatacagacctaccgctctgtcagtgagatggcttctaacaagtttaaaaga
atgctgaaccgggagctgacacacctgtcagagatgagccgatcagggaaccaggtgtct
gaatacatttcaaacactttcttagacaagcagaacgatgtggaaattccatctcccacc
cagaaagacagggagaaaaagaaaaagcagcagctcatgacccagataagtggagtgaaa
aaactgatgcacagttcaagcttaaacaatacgagcatctcacgctttggagttagcacg
gaaaatgaagaccatctggccaaggagctggaggacctgaacaaatggggccttaacatc
ttcaatgtggctggatattcacacaacaggcctctaacatgcatcatgtatgccatattc
caggaaagagacctcctaaagacattcaaaatctcatctgacacatttgtaacctacatg
atgactttggaagaccattaccattctgacgtggcatatcataacagcctacatgctgct
gatgtagcccagtcaacccatgttcttctttctacgccagcattagatgccgtcttcaca
gatttggaaattctggccgccatttttgcagctgctatccatgatgtcgatcatcctggc
gtctccaatcagtttctcatcaacacaaattcagaacttgccttgatgtataatgatgaa
tctgtcttggaaaaccaccaccttgccgtgggtttcaaactgctgcaagaagaacactgt
gacatcttccagaatctcaccaagaagcagcgtcagacactcaggaaaatggttattgac
atggtgttagcaacggatatgtccaagcatatgagcctgttggcagacctgaagacaatg
gtagaaacaaagaaagttacaagctcaggtgttcttctcctggataactatactgatcgt
atacaggtccttcgcaacatggtacactgtgcagacctgagcaaccccaccaaatccctg
gaattgtatcggcaatggacagaccgcatcatggaggaatttttccagcagggagacaaa
gagcgggagaggggaatggagattagcccaatgtgtgataaacacacagcttctgtggaa
aaatcccaggttggtttcattgactacattgtccatccactgtgggagacctgggcagat
ctggtacagcctgatgcccaggacattctggatacgttagaagataacaggaactggtat
cagagcatgataccccagagtccctccccaccactggacgagcgaaacagagattgccag
ggtctgatggagaagtttcagtttgaactgactcttgaagaagaggattcagaaggacat
gaaaaggagggagagggccacaactatttcagtagcacaaagacactttgtgtgatccat
ccagaaaatagggattccctggaagagactgatgtagagattgcgacagaagacaagtct
ccaattgacacataa

KEGG   Loxodonta africana (African savanna elephant): 100671572
Entry
100671572         CDS       T04351                                 

Gene name
PDE4C
Definition
(RefSeq) LOW QUALITY PROTEIN: cAMP-specific 3',5'-cyclic phosphodiesterase 4C
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04024  cAMP signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100671572 (PDE4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100671572 (PDE4C)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100671572 (PDE4C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100671572 (PDE4C)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100671572 (PDE4C)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 100671572
NCBI-ProteinID: XP_023407625
LinkDB
Position
Unknown
AA seq 1093 aa
MADPHPPPPQLLLLLVLTVLLKCAGGFGTTPAGDPKVPESHRNPGVVVVVCLLVSVLLIG
SVVLALRRCHQGEAEFQRLDEVSMRTWESADSGSVPVSPLGAGVIRRRFSGTPLLPPLSN
RLGPPGEVEPDAPVLFTIEAQGPEWSHGPAPGRDSAIYVYLRRPEPLTLLPDPPCRCHWG
GLRTRHCSPLSFQHLLGGQRPGLGVCRNPCLSAQPSASAGPGQLLAVATTLIPLNLRSFS
FSTRERDSAAALEGGLLSPCLPAPHSAKTGGQFLPLPPQALLLSLFHSWPCGGGWSSQPL
PAPSFHPCHPSAPAGYGQLLGVFPTLXAPYSTFSRLSISIADSPSLSPXTPAPGRTQAAP
SPPRPSPLLWLMETPGVGEGAEASTGLSSARSRQGTARPPKHLWRQPRRPISIQQRFHSD
PDKSVRRSGLEKSRRSWPNSFPRRFDLENGLSCGRSALDTQASSGLGRASQTSAPHSQRR
ESFLYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAAFAHLQG
RGAAKYAEGGARRRGRDRSVRGKVPEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMA
SNKFKRMLNRELSHLSETSRSGNQVSEYIFQTFLDQQTEVELPRVTPVETPRPMSQISGL
RELPHSASLSTASVPRFGIQTDQEEQLAKELEDTNKWGLDVFRVAELSRNQPLTVIMFSI
FQERDLLKTFRIPAGTLITYLLTLESHYHADVAYHNSLHAADVAQSTHVLLATPALEAVF
TDLEVLAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLALGFKLLQTEN
CDIFQNLSAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVASLGVLLLDNYSD
RIQVLQNLVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERETGLDISPMCDKHTASV
EKSQVGFIDYIAHPLWETWADLVHPDAQGLLDTLEDNRAWYQSRIPCSPLAPRSPQRGGP
DRFQFELTLEEEEEEEEGEPVALDREASELPDIELLSPKTSPDPQIPQLDNQRTVGKPLT
DCEGNVMAKPFGT
NT seq 3282 nt   +upstreamnt  +downstreamnt
atggcggaccctcatccgccaccgccgcagctgctgctgcttctggtgctgacagtgctg
ctgaaatgtgctgggggtttcggtaccacccctgcaggtgaccccaaggtccctgagtca
cacagaaatccaggcgtggtggtggtggtgtgcctgctggtgtctgtcctgcttattggt
tccgtggtgctggccttgaggcgttgccaccagggggaggccgagttccagaggctggat
gaggtgtccatgcgaacctgggagtcagcagattctggctcggtccccgtgagccccctt
ggtgctggtgttatccggagacgtttctcagggactcccttgctgccaccgctgtcaaac
cgcctcgggcccccaggtgaggttgagcctgatgcccctgtcctgttcaccatcgaggct
caagggccagagtggagccacggtccagccccaggcagagactccgccatctatgtctac
ctccgaagaccagagcccttaactctgcttccagatcctccttgccgctgtcactgggga
gggttaaggacccgccactgttcacctctcagctttcagcatctcctgggcggacagcgc
cctggtctgggggtgtgtcgaaacccctgtctctctgcgcaaccttcagcatcagccggg
cccggacagcttctcgctgtcgcaactactctgatccccctgaaccttagaagcttctct
ttcagcaccagagagagggacagcgccgcggcgcttgaggggggtctcctgagcccctgc
cttcctgccccacattcagccaaaaccggagggcaatttctgcctctaccacctcaagcc
cttctcttgagcctcttccattcttggccctgcgggggggggtggtcttcccagcccctg
cctgccccatccttccacccctgccacccttcagcaccagccgggtacggacagctccta
ggtgtttttcctaccttataagccccttattctaccttctcccggcttagcatctccatc
gcagacagcccctcactgtcgcccngcacccccgcccctggtcggacccaggcggctccg
agccctcctcgcccctctcccctcctctggctcatggagacccccggggtcggcgaaggg
gcggaggcatccaccgggctgagcagtgctcgtagccgccaaggcacagccaggccgccg
aagcacctgtggcggcagccccggcgccccatcagcatccagcagcgcttccactcggac
ccggacaagtcggtgcgccggtccgggctggagaagtcgcggcgttcctggcccaactcc
ttccccaggcgctttgacctggaaaatgggctctcatgcgggaggagcgccctggatact
caggccagctcaggcctgggccgggccagccagacctctgccccccacagccagcggcgg
gagtccttcctgtaccgttcagacagcgactacgagctctcgcccaaggctatgtccagg
aactcctccgtggctagtgacctacatggagaggacatgattgtgacgccctttgcgcag
gtcctggccagtctgcggacggttcggagcaacgtggcggccttcgcccacctgcaaggc
cgcggggccgccaagtacgcagagggtggggccaggaggagggggcgggaccgctcggta
cgggggaaggtgccagaggacactgggcagaagttggcattggagacactggacgagttg
gactggtgcctggaccagctggagacgctgcagacacggcattcagtgggggagatggcc
tccaacaagttcaagcgaatgctgaaccgcgagttgagccacctgtcggaaaccagccgc
tctgggaaccaggtgtcggagtacatcttccagaccttcctggaccaacagactgaggtg
gagttgcccagggtgacccccgtggagaccccaaggcccatgtcccagatcagcggcctg
cgtgagctcccccacagtgccagcctctctactgcctctgtccctcgctttggcatccag
actgaccaggaggagcaactggccaaggagttggaagacaccaacaagtgggggcttgac
gtgttcagggtagcagagctaagcaggaaccagcccctcacagtcatcatgttcagcatc
tttcaggaacgggacctactcaagacattccggatcccagctggcacactcatcacctac
ctgctgacactggagagccactaccatgctgatgtggcctaccacaacagcttacatgct
gctgacgtggcacagtccacgcacgtgttgctggctacacccgccctcgaggctgtgttc
acagacctggaagtcctggctgccatctttgcaagtgctattcatgacgtggaccatcct
ggggtttccaaccagtttctgatcaacaccaactcagagcttgcactcatgtacaatgat
gcctccgtgctggagaaccaccacctggctctgggcttcaagctattgcagacagagaac
tgtgacatcttccagaacctcagtgccaagcagcggctgagcttgcgcaggatggtcatt
gacatggtgctggccacagacatgtccaaacacatgaacctactagctgacctcaagacc
atggtagagaccaagaaggtagccagcctcggcgtcctgctgctggacaactactctgac
cgcatccaggtcctgcagaacttggtgcactgtgctgacctcagcaaccccaccaagccg
ctgcccctgtaccgccagtggactgaccgcatcatggctgagttcttccagcagggtgac
cgggagcgcgagacaggcctggacattagccctatgtgtgacaagcacacggcctctgtg
gagaagtcccaggtgggtttcatagactacatcgcccacccactgtgggagacatgggcc
gaccttgtgcacccagatgcccagggcctgctggacacactggaggacaaccgcgcatgg
taccagagcaggatcccctgcagccccctggcccccagaagcccccagcgtggcggtcct
gacaggttccagtttgagctgaccctggaggaggaagaggaggaggaggaaggagagccg
gtggcattggatagggaggcttcagagttgcctgacattgagctcctgtcccccaagacc
agcccagacccccagatcccacagctggacaaccagaggaccgtgggcaagcctctcaca
gactgtgagggcaacgtgatggccaagccctttggcacctaa

KEGG   Loxodonta africana (African savanna elephant): 100671668
Entry
100671668         CDS       T04351                                 

Gene name
PDE4A
Definition
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 4A
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04024  cAMP signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100671668 (PDE4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100671668 (PDE4A)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100671668 (PDE4A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100671668 (PDE4A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100671668 (PDE4A)
SSDB
Motif
Pfam: PDE4_UCR PDEase_I
Other DBs
NCBI-GeneID: 100671668
NCBI-ProteinID: XP_023407662
LinkDB
Position
Unknown
AA seq 452 aa
MLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEILSPTMKEREKQHAPRQQRPPQHPP
PPVPQFQPMSQITGVKKLMHSSGLNSASIPRFGVKTDQEELLAHELENLNKWGLNIFRVS
DYAGVYNKTNCPSMYILRCFQFLFIFSFFFFLLVQELWWIWRSKIAGSSGTNVFFHFCRS
HSVVVPSAPGGNVLMLFLLPQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNRDWYYS
AIRQSPSPPPEEEPGGPGHPPPPDKFQFELTLEEEEEEEVTTAQITATAQDASTVQELSL
AQKVPITAKDTSVIAPAASPAEKLLEVKGQDPSTEVEIEEVYLTRLADPAENGSMTQDQS
TSQDTSVALDAVSCSSPPVLFPESPPLSALRTPPPEEEAPGLLGLPSTAAEVGAQREHQA
AKRSCSVCTGTSSQDPATLPAPSEWGAGGGPT
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgctaaaccgtgagctcacacacctgtcagaaatgagcaggtcaggaaaccaggtctct
gagtacatctccacaacattcctggacaagcagaacgaagtagagatcctatcacccacg
atgaaggagcgagagaaacagcacgcaccgcggcagcagcgacccccccagcaccccccg
ccccctgtgccgcagttccagcccatgtctcagatcacgggcgtcaagaaactgatgcac
agcagcggcctgaacagcgccagcatcccccgctttggggtgaagactgatcaagaggag
ctcttagcccacgagctggagaacctgaataagtggggcctgaacatcttccgtgtgtcg
gactacgccggagtttacaacaaaactaattgcccatccatgtacatattgaggtgtttc
cagtttttgtttatattctcatttttttttttcttacttgtgcaagagctttggtggatc
tggagaagtaaaattgctgggtcaagtggtacaaatgtcttttttcatttttgtagatct
cacagtgtggtggtgccatctgcaccaggaggcaacgtgttgatgctctttcttcttccc
caggtgggtttcattgactatatcgtgcacccgctgtgggagacatgggctgacctggtc
cacccagatgcccaggagatcctggacacactggaggacaatcgggactggtactacagc
gccattcggcagagcccttcaccaccgccggaggaggagcctggggggccaggccaccca
cccccacctgataagttccagtttgagttgactctggaggaggaagaggaggaggaggtg
accacagcccagataacagccacagcccaagatgcgtccacagtgcaagaactgtccttg
gcccaaaaagtgcccatcacagccaaggacacatctgtcatagccccggctgcatcccca
gctgagaagctgttggaggtcaagggccaggacccatccacagaggtagagatagaggaa
gtgtatttgacacggctggcagacccagccgagaatgggtctatgacgcaggaccagtcc
acgtcccaggacacatctgtggctctggatgctgtaagctgcagcagcccccctgtcctg
ttccctgaaagcccccctctgtctgccttgaggaccccaccccctgaagaggaggccccg
ggcctcctgggcctcccctccacggcggccgaggtgggggcccaaagggagcatcaggct
gccaagaggtcgtgcagtgtgtgcactgggacatccagccaggatccagccacattgcca
gctcccagcgagtggggggcaggtggaggccctacctga

DBGET integrated database retrieval system