KEGG   Loxodonta africana (African savanna elephant): 100656597
Entry
100656597         CDS       T04351                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X3
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04115  p53 signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04370  VEGF signaling pathway
lav04919  Thyroid hormone signaling pathway
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05134  Legionellosis
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05215  Prostate cancer
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100656597 (CASP9)
   04151 PI3K-Akt signaling pathway
    100656597 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100656597 (CASP9)
   04215 Apoptosis - multiple species
    100656597 (CASP9)
   04115 p53 signaling pathway
    100656597 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100656597 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100656597 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100656597 (CASP9)
   05212 Pancreatic cancer
    100656597 (CASP9)
   05215 Prostate cancer
    100656597 (CASP9)
   05213 Endometrial cancer
    100656597 (CASP9)
   05222 Small cell lung cancer
    100656597 (CASP9)
   05223 Non-small cell lung cancer
    100656597 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100656597 (CASP9)
   05012 Parkinson disease
    100656597 (CASP9)
   05014 Amyotrophic lateral sclerosis
    100656597 (CASP9)
   05016 Huntington disease
    100656597 (CASP9)
   05020 Prion disease
    100656597 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    100656597 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100656597 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100656597 (CASP9)
   05152 Tuberculosis
    100656597 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100656597 (CASP9)
   05161 Hepatitis B
    100656597 (CASP9)
   05160 Hepatitis C
    100656597 (CASP9)
   05164 Influenza A
    100656597 (CASP9)
   05162 Measles
    100656597 (CASP9)
   05168 Herpes simplex virus 1 infection
    100656597 (CASP9)
   05163 Human cytomegalovirus infection
    100656597 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100656597 (CASP9)
   05169 Epstein-Barr virus infection
    100656597 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100656597 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100656597 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100656597 (CASP9)
   01002 Peptidases and inhibitors [BR:lav01002]
    100656597 (CASP9)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100656597 (CASP9)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100656597 (CASP9)
Peptidases and inhibitors [BR:lav01002]
 Cysteine peptidases
  Family C14: caspase family
   100656597 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 100656597
NCBI-ProteinID: XP_010591399
LinkDB
Position
Unknown
AA seq 448 aa
MDEADRQLLRRCRVRLVRELQVAELWDALLNRGLFTPDMIEDIQRAGSGSRRDQARQLVT
DLETRGSQALPLFISCLQDTGQDMLASLLSTSCQAAKEHLDVRPLDLVHGPMGLNPGELR
AVKQDPSRLNMRHLPTVVLGPDKLRPAELRPEVLRPEVPRPVTIGSGGLRDACALRPGGN
TDLAYVLDADPCGYCLILNNVNFCLQSGLGTRTGSNIDCEKLQRRFRLLHFMVEVKCDLT
AKEMFLALVELAQRDHGALDCCVVVILSHGCQVSHRQFPGAVYGTDGNSVSIERIVNIFN
GTGCPSLGGKPKLFFIQACGGEQKDHGFEVASASPKNRASGRNPESDAAPLLEGLGNSDQ
PDAVASLPTPSDIFVSYSTFPGFVSWRDTKSGSWYVKTLDAVFEQWAGSEDLQTLLLRVA
NAVSEKGIYKQMPGYFNFLRKKLFFKTC
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggacgaggccgatcggcagctcctgcggcggtgccgggtgcgactggtccgcgaactg
caggtggctgagctctgggacgcgctgcttaaccgcgggctcttcacgcctgacatgatc
gaagacatccagcgggcaggctctggatctcggcgggatcaggccaggcagctggtcaca
gatctagagactcgagggagccaggcccttcctttgttcatctcctgcttacaggataca
ggccaggacatgctggcttcattactgagcacgagttgccaagcagcaaaggagcatctg
gatgtcagacccctggacctcgtgcatggaccaatgggcctcaacccaggtgagctgaga
gcggttaagcaggatccatcgaggttgaacatgcgacatctccctacagtggtgctggga
cctgacaagctccgaccagctgagctcaggccagaggttctcagaccagaggtgcccagg
ccagtgaccattggctctggaggactccgtgatgcctgtgctctgagaccgggaggaaac
actgatttggcatacgtcctggacgccgacccttgtggctactgcctcattctcaacaat
gtgaacttctgcctccagtcggggcttggcacccgcactggctccaatattgactgtgaa
aagttgcagcgacgtttccgattgctgcatttcatggtggaggtgaagtgtgacctgact
gccaaggaaatgttcctggccctggtggagctggcacagcgggaccatggtgctctggac
tgctgtgtggtggtcatcctctcccacggctgtcaggtcagtcaccgccagttcccgggg
gccgtctatggcacggatggaaattctgtgtccattgagagaattgtgaacatcttcaat
ggaaccggctgcccaagcttgggagggaagcccaagctctttttcatccaggcctgtggt
ggggagcagaaagaccatggatttgaggtggcctctgcttcccctaaaaacagggcctct
ggcagaaaccccgagtcagatgccgccccgttgctggaaggcctggggaactctgaccag
ccagatgccgtggctagtttgcccacacccagtgatatcttcgtgtcctactccaccttc
ccagggtttgtctcctggagggataccaagagtggttcctggtacgtcaagactctggat
gctgtctttgagcagtgggctggctctgaagacctacagaccctcctgctcagggtcgcc
aatgctgtttcagagaaagggatttacaaacagatgccaggttattttaatttcctccgg
aaaaaacttttctttaaaacttgttga

DBGET integrated database retrieval system