KEGG   Loxodonta africana (African savanna elephant): 100656623
Entry
100656623         CDS       T04351                                 

Gene name
PLA2G3
Definition
(RefSeq) group 3 secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100656623 (PLA2G3)
   00565 Ether lipid metabolism
    100656623 (PLA2G3)
   00590 Arachidonic acid metabolism
    100656623 (PLA2G3)
   00591 Linoleic acid metabolism
    100656623 (PLA2G3)
   00592 alpha-Linolenic acid metabolism
    100656623 (PLA2G3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100656623 (PLA2G3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100656623 (PLA2G3)
  09154 Digestive system
   04972 Pancreatic secretion
    100656623 (PLA2G3)
   04975 Fat digestion and absorption
    100656623 (PLA2G3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100656623 (PLA2G3)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100656623 (PLA2G3)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100656623 (PLA2G3)
SSDB
Motif
Pfam: Phospholip_A2_2 Chromadorea_ALT
Other DBs
NCBI-GeneID: 100656623
NCBI-ProteinID: XP_003419183
LinkDB
Position
Unknown
AA seq 495 aa
MGVLWVLWVLGFLGVALGGSSALCWDSTSCHLAGPVPGGPLEFLSFLGKDARGLALFHIR
WDGRGRLQMCSRQDEPKLTATFRTLCVHETTRGAFTHTPGPELQRALNTIQSQWEACQGS
AEQPAAEARKKRAAGQSGASGGGYHRARRGWTMPGTLWCGVGDSASNSSELGVFQGPDLC
CREHDRCPQNISPFQYKYGIRNYRFHTISHCDCDVRFQQCLWNQRDSISDIVGVAFFNVL
EIPCFVLQHQEACVAWYWWGGCRMYGSVPLARLQPRILYNASWSPLLGTTPLTPSPVPTK
PQRKQHSRKWPPQLEGPNHLSKVRVTALWVPRSRLQGTWDGLKPEGARHACRSFRRLDQC
EHQIRHQETKFQLLNSAHMPLFHCNCTRRPVHFLRLHSPPAGTKVLWELLGQTCFKLAPP
RACAEGKSCPGGPRAIKVSARHLQWLQQRRLQLWGAGTDERQAWPSEPTGAPVTFYNQCL
WLTQAARSPSGQQKP
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgggggttctgtgggtgctgtgggtgctaggcttcctgggggtggctctggggggctct
tctgctctctgctgggacagcacctcctgccatttggctgggcctgtgcccggtggcccc
ctggagtttctgagcttcctgggcaaggatgcccggggactggccctgttccatatccgc
tgggatgggcgtggaaggctgcagatgtgtagccgtcaggacgagcccaagctcaccgca
accttccgcaccctctgtgttcatgagaccacccggggcgccttcacccacacccctggg
cctgagctgcagagagccctgaacaccattcagagtcaatgggaggcctgccaagggtct
gcggaacagccggcagcagaggccaggaagaagcgagcagccgggcagagtggagcatct
ggtgggggataccaccgggccaggagaggctggaccatgcctggcacgctgtggtgtggc
gttggggactctgccagcaactcctcagagctgggggtcttccagggccccgatctctgc
tgccgagaacacgaccgctgcccacaaaacatctcacccttccagtataagtatggcatc
agaaactaccgcttccataccatctcccactgcgactgtgatgtcaggttccagcaatgc
ttgtggaaccagcgtgactccatctcagacatcgtgggtgtggctttcttcaacgtgcta
gagatcccctgctttgtgctgcagcatcaggaggcgtgtgtggcgtggtactggtggggt
gggtgtaggatgtatggttcagtgccccttgcccgtctccagcccaggatcctctacaac
gcctcctggagcccccttctgggaaccacccccctaactcccagtccagtccccaccaag
ccccaacgcaagcagcactctaggaagtggccaccacagctggaagggcccaaccacctc
agtaaagtcagagttacggctctctgggtcccccgttcacgcctccaggggacatgggat
ggcctaaaaccagaaggcgctcgccatgcctgccgcagcttccgccgcctagaccagtgt
gagcaccagattaggcaccaggagaccaagttccagcttctcaacagcgcccacatgccc
ctcttccactgcaactgcacacgccgcccggtacacttcctgagactccacagcccacct
gcaggcaccaaggtgctttgggagcttctgggccagacctgcttcaagctggcccctccg
cgggcctgtgctgagggcaaaagctgtcctggaggccctagggccatcaaggtgtcagct
cgacacttgcagtggcttcagcagaggcgactccagctctggggtgcaggtacagacgag
aggcaggcatggccttcagaacccacaggggcccccgtgacattctacaaccagtgcctg
tggctgacccaggcagcccggagccccagtgggcagcagaaaccctga

KEGG   Loxodonta africana (African savanna elephant): 100658490
Entry
100658490         CDS       T04351                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2 isoform X2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04072  Phospholipase D signaling pathway
lav04217  Necroptosis
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04611  Platelet activation
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04921  Oxytocin signaling pathway
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100658490 (PLA2G4A)
   00565 Ether lipid metabolism
    100658490 (PLA2G4A)
   00590 Arachidonic acid metabolism
    100658490 (PLA2G4A)
   00591 Linoleic acid metabolism
    100658490 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    100658490 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100658490 (PLA2G4A)
   04014 Ras signaling pathway
    100658490 (PLA2G4A)
   04370 VEGF signaling pathway
    100658490 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    100658490 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100658490 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100658490 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    100658490 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    100658490 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100658490 (PLA2G4A)
   04913 Ovarian steroidogenesis
    100658490 (PLA2G4A)
   04921 Oxytocin signaling pathway
    100658490 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100658490 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    100658490 (PLA2G4A)
   04726 Serotonergic synapse
    100658490 (PLA2G4A)
   04730 Long-term depression
    100658490 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100658490 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100658490 (PLA2G4A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100658490 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 100658490
NCBI-ProteinID: XP_010589241
LinkDB
Position
Unknown
AA seq 749 aa
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFICTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFPISSMKVGEKKEV
PFIFNQVTEMILEMSLEVCSAPDLRFSMALCDQEKTFRQQRKEKIKENMKKLLGPENSEG
LYSTRDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYIAGLSGSTWYMSTLYSD
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKIKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSASQSKGSTMEEE
LENITAKHIVSNDSSDSDDESQEPKGTENEDAERDYQNDNQASWVHRMLMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLRGFTTQESLDEDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDVEKDCPTIIHFVLANINFRKYKSPGVPRETK
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKKAIIESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKTTA
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcatttatagatccttatcagcacattatagtggagcaccagtattcccacaagttc
actgtcgtggtgttacgtgccaccaaagtgacaaagggggccttcggtgacatgcttgat
actccagatccgtatgtggaacttttcatctgtaccactcctgacagcaggaaaagaaca
agacacttcaataatgacataaatcccgtgtggaatgagacctttgaatttattttggat
cctaatcaggaaaatgttttggagatcacattaatggatgccaattatgttatggatgaa
actctagggacagcaacatttcctatatcttctatgaaagtgggagagaagaaggaagtt
ccctttattttcaaccaagtcactgaaatgattctggaaatgtctcttgaagtttgctca
gccccagaccttcgatttagcatggctctctgtgatcaggagaaaactttcagacaacaa
agaaaagaaaaaataaaggagaacatgaagaaactcttgggtccagagaatagtgaaggc
ttgtattctacccgtgatgtgcctgtggtggccatattgggctcaggtgggggcttccga
gccatggtgggcttctccggtgtgatgaaggcactgtatgaatcagggattttggattgc
gccacctacattgctggtctttctggctccacatggtacatgtcaaccttatattctgat
cctgattttccagagaaagggccagaggagattaatgaagagttaatgaaaaatgttagc
cacaatccccttttacttctcacaccacagaagattaaacgatatgttgagtctttatgg
aagaagaaaagctctgggcaacctgtcacctttactgatatctttggaatgttaatagga
gaaacactaattcacaatagaatgaacactacgttaagtagtttgaaggaaaaagtcaac
actgcacaatgccctttacctcttttcacctgtctccatgtcaaacccgatgtttcggag
ttgatgtttgcagattgggttgaatttagtccatatgagattggcatggctaaatatggt
acttttatggcccctgacttatttggaagcaaattttttatgggaacagttgtgaagaaa
tatgaagaaaatcccttgcattttttaatgggtgtctggggaagtgctttttctatatta
ttcaacagagtcttgggtgtttctgcttcacaaagtaaaggttccacaatggaggaagaa
ttagaaaatattacagcgaaacatattgtgagtaatgatagctcggatagtgatgatgaa
tcacaagagcccaaaggcactgaaaatgaagatgccgaaagggactatcaaaatgataat
caagcaagttgggttcatcgaatgttaatggccttggtgagtgattcagctttattcaat
acccgagaaggacgtgctgggaaggtgcacaacttcatgttgggcttgaatctcaataca
tcctatccactgtctcctttgagaggctttaccacacaggagtccttggatgaagatgaa
ttggatgcagctgtggcagatcctgatgaatttgaaagaatatatgagcccctggatgtc
aaaagtaaaaagatccatgtagtggacagtgggctcacatttaacctgccctatcctttg
atcctgagaccacagagaggggtagatctcatcatttcctttgacttttctgcaagacca
agtgactccagtcctcccttcaaggaacttctacttgcagaaaagtgggctaaaatgaac
aagctcccttttccaaagattgatccttatgtgtttgatcgggaaggactgaaggagtgc
tatgtctttaaacccaagaaccctgatgtggagaaagattgcccaactatcattcacttt
gttctggccaacatcaacttcagaaagtacaagtctccaggtgttccaagagaaactaag
gaagagaaagaaatagctgactttgacatttttgatgatccagaatcaccattttcaacc
ttcaactttcaatatccaaatcaagcattcaaaaggctgcatgatctaatgcacttcaat
accctgaacaacattgatgtgataaagaaagccataattgaaagcatcgaatatagaaga
cagaatccatctcgttgctctgtttctctcagtaatgttgaggcaagacgattcttcaac
aaagagtttctaagcaaaaccacagcatag

KEGG   Loxodonta africana (African savanna elephant): 100660480
Entry
100660480         CDS       T04351                                 

Gene name
PLA2G12A
Definition
(RefSeq) group XIIA secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100660480 (PLA2G12A)
   00565 Ether lipid metabolism
    100660480 (PLA2G12A)
   00590 Arachidonic acid metabolism
    100660480 (PLA2G12A)
   00591 Linoleic acid metabolism
    100660480 (PLA2G12A)
   00592 alpha-Linolenic acid metabolism
    100660480 (PLA2G12A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100660480 (PLA2G12A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100660480 (PLA2G12A)
  09154 Digestive system
   04972 Pancreatic secretion
    100660480 (PLA2G12A)
   04975 Fat digestion and absorption
    100660480 (PLA2G12A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100660480 (PLA2G12A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100660480 (PLA2G12A)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100660480 (PLA2G12A)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 100660480
NCBI-ProteinID: XP_003410444
UniProt: G3SMG6
LinkDB
Position
Unknown
AA seq 191 aa
MAPLVRPRSALALLILVLAAAVRCQAQAQTTDWRATLKTIRNGVHRIDTYLNAALDLLGG
EDGLCQYKCNDGSKPYPRHGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCG
KSKNDCDEAFQYCLSKICRDVQKTLGLAQHVQACETTVELLFDSVIHLGCKPYLDSQRAA
CWCRYEEKTDL
NT seq 576 nt   +upstreamnt  +downstreamnt
atggctccgctcgtgcggccgcgatccgcgctcgccctcctgatcctcgtcctagccgcc
gccgtcaggtgccaggctcaggcccagaccacagactggagggccacgcttaagaccatc
cggaatggcgttcacaggatagacacctacctgaacgccgccttggacctcctgggaggc
gaggacgggctttgccaatataagtgcaatgacggatctaagccttacccacgtcatggt
tataaaccctccccaccgaatggatgtggctctccgctgtttggtgttcatctgaacatt
ggcatcccatccctgacgaagtgctgcaaccaacacgacaggtgctacgagacctgcggc
aaaagcaagaatgactgtgacgaggcgttccagtactgcctgtccaagatctgccgagat
gtgcagaaaacactaggactagctcagcatgttcaggcatgtgaaacaacagtggagctc
ttgtttgacagcgttatccatttaggctgtaaaccatacctggacagccaaagagctgca
tgctggtgtcgctatgaagaaaaaacggatctttaa

KEGG   Loxodonta africana (African savanna elephant): 100662745
Entry
100662745         CDS       T04351                                 

Gene name
PLA2G12B
Definition
(RefSeq) group XIIB secretory phospholipase A2-like protein
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100662745 (PLA2G12B)
   00565 Ether lipid metabolism
    100662745 (PLA2G12B)
   00590 Arachidonic acid metabolism
    100662745 (PLA2G12B)
   00591 Linoleic acid metabolism
    100662745 (PLA2G12B)
   00592 alpha-Linolenic acid metabolism
    100662745 (PLA2G12B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100662745 (PLA2G12B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100662745 (PLA2G12B)
  09154 Digestive system
   04972 Pancreatic secretion
    100662745 (PLA2G12B)
   04975 Fat digestion and absorption
    100662745 (PLA2G12B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100662745 (PLA2G12B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100662745 (PLA2G12B)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100662745 (PLA2G12B)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 100662745
NCBI-ProteinID: XP_003408940
UniProt: G3T3B3
LinkDB
Position
Unknown
AA seq 195 aa
MKLTTGCLLLWLSMGGGLAQTDTNPDTEESYADWGLRHIRGSFESVNSYFDSFLELLGGR
NGVCQYRCRYGKAPMPRPGYKPQEPNGCSSYFLGLKVPERMDLGIPAMTKCCNQLDICYD
TCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEVACDSLADTVFNTVWTLGCRPFMNS
QRAACICAEEEKEEL
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctgaccacaggctgcttgcttttgtggctcagcatggggggtggcctggctcag
acagacaccaaccctgacacagaagaatcctatgcagactggggccttcggcacatccgg
ggcagctttgaatctgtcaacagctactttgattcctttctggagctgctgggagggaga
aatggagtctgtcagtacaggtgccgatacggaaaggcaccaatgcccaggcctggctac
aaacctcaggaacccaacggctgcagctcctacttcctgggtctcaaggtaccagaaaga
atggacttgggcattccagcaatgaccaagtgctgcaaccagctggacatctgctatgac
acgtgtggtgccaacaagtatcgctgtgatgcaaagttccgatggtgtctccactctatc
tgctccgaccttaagcggagtctgggatttgtctccaaagtggaagtagcttgtgattca
ctggctgatacggtgttcaatactgtatggaccttgggctgccgaccctttatgaatagt
cagcgggcagcctgcatctgtgcagaggaggagaaagaagagttatga

KEGG   Loxodonta africana (African savanna elephant): 100665160
Entry
100665160         CDS       T04351                                 

Gene name
PLA2G6
Definition
(RefSeq) 85/88 kDa calcium-independent phospholipase A2
  KO
K16343  calcium-independent phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04666  Fc gamma R-mediated phagocytosis
lav04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100665160 (PLA2G6)
   00565 Ether lipid metabolism
    100665160 (PLA2G6)
   00590 Arachidonic acid metabolism
    100665160 (PLA2G6)
   00591 Linoleic acid metabolism
    100665160 (PLA2G6)
   00592 alpha-Linolenic acid metabolism
    100665160 (PLA2G6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100665160 (PLA2G6)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100665160 (PLA2G6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100665160 (PLA2G6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100665160 (PLA2G6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lav03029]
    100665160 (PLA2G6)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100665160 (PLA2G6)
Mitochondrial biogenesis [BR:lav03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    100665160 (PLA2G6)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3 Patatin
Other DBs
NCBI-GeneID: 100665160
NCBI-ProteinID: XP_023415758
LinkDB
Position
Unknown
AA seq 839 aa
MGDRAQLTRDPVLFQSEGAGSQASAPSPRKMQFFGRLVNTLSSVTNLFSNPFRVKEVSVA
DYNVSSRVREEGQLVLFHNTPNRTWDCVLVNPRNSQSGFRLFQLEVEADALVNFQQYSSQ
LLPFYESSPQVLNVEVLQHLTDLIRNHPSWSAAHLAVELGIRECFRHSRIISCANSTEDE
EGCTPLHLACRKGDGETLVELVQYCHAQMDVTDKSGETAFHYAVQGDNPQVLQLLGKGAS
AGLNHVNNQGLTPLHLACQMGKQEMVRVLLLCNARCNVLGPGGYPIHTAMKFSQKGCAEM
IIGMDSNQIHSKDPRYGASPLHWAKNAEMARMLLKRGCDVNSTSFAGNTALHVAVMRNRF
ECVMVLLTYGANADARGEHGNTPLHLAMSKDNVEMIKALIVFGAEVDTPNDFGETPAFIA
NRVSKLVTRKTLLTLLRTVGADYHFPLTPGDPMEQGSAASQHPLFSLERAQRPSVSLSNL
ELQDITHITRARKPAFILNSLRDETRSRDHLLCLDGGGVKGLVIIQLLIAIEKASGVATK
DLFDWVAGTSTGGILALAILHNKSMAYMRGVYFRMKDEVFRGSRPYESGPLEEFLKREFG
EHTKMTDIKKPKVMLTGTLSDRQPAELHLFRNYDAPDTIREPRFSQNANLRPPTQPSEQL
VWRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEIHEYNQDMIRKGQGHKVKKLSI
VVSLGTGRSPQVPVTCVDVFRPSNPWELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAW
CEMVSIQYFRLNTQLGTDIMLDEVSDLVMVNALWETEVYIYELGQRTHRGRRLGPQGQA
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgggagaccgcgcccagctgaccagagaccctgttctcttccagtctgagggggcaggc
agccaggcctctgcgcccagcccacggaagatgcagttcttcggccgcctggtcaacacc
ctcagtagcgtcaccaacttgttctctaacccgttccgggtgaaagaggtgtctgtagca
gactacaacgtgagcagccgggttcgagaggaagggcaactggttctgttccacaacacc
cccaatcgcacctgggactgcgtcctggtcaaccccaggaactcacagagtggattccgg
ctcttccagctggaggtggaggccgacgccctggtgaacttccagcagtactcttcccag
ctgctgcccttctacgagagctcgccccaggtcctgaacgtagaggtcctgcagcatctg
actgacctcatccgcaaccaccccagctggtcggcggcccacttggcggtggaattgggg
atccgggagtgtttccgccacagccgcatcatcagctgtgccaacagcaccgaggatgag
gaaggctgcacacccctgcacctggcctgccgcaagggtgacggggagaccctggtggag
ctggtgcagtactgccacgcccagatggacgtcaccgacaaaagcggagagaccgccttc
cactacgctgtccagggtgacaacccccaggtgctgcagctcctaggcaagggcgcatcg
gccggcctgaaccacgtcaacaaccaagggctgaccccgctgcacctggcctgccagatg
gggaagcaggagatggtgcgcgtgctgcttctctgcaatgcccgatgcaacgtcctgggg
cctggcggctaccccatccacaccgccatgaagttctcccagaaggggtgtgctgaaatg
atcataggcatggacagcaaccagatccacagcaaagaccctcgctatggagccagtccc
ctgcactgggccaagaatgcagagatggcccgcatgctgctgaagcggggctgcgacgtg
aacagcaccagcttcgcgggaaacacagccctgcacgtggcagtgatgcgcaaccgcttc
gaatgcgtcatggtgttgctgacctacggggccaacgctgatgcccgcggcgagcacggc
aacaccccgctgcacctggccatgtcgaaagacaacgtggagatgatcaaggccctcatt
gtctttggggcagaggtggataccccaaatgactttggggagactcctgcattcatagcc
aacagagtcagcaaacttgttaccaggaagacgctcttaactctgctgagaactgtaggg
gccgactaccacttcccactcacccccggggaccccatggaacagggctctgcagcatca
cagcaccccctcttctccctggaaagagcacagcgcccatcagtcagcctaagcaaccta
gagctgcaggatattacacacatcacccgggcccggaagccggccttcatcctgaactcc
ctgcgggacgagacgcgcagccgcgaccacctgctctgcctggacggagggggtgtgaaa
ggactcgtcatcatccagctcctcatcgccatcgagaaggcctcaggcgtcgccaccaag
gacctctttgactgggtggctgggaccagtacggggggcatcctggccctggccattctg
cacaacaagtccatggcctacatgcgcggcgtgtacttccgcatgaaggacgaagtgttc
cggggctcacggccctacgagtcgggacctctggaggagtttctgaagcgggagttcggt
gagcacaccaagatgacagacatcaagaaacccaaggtgatgctgacagggacactgtct
gacaggcagcctgctgaactccacctcttccggaattacgatgccccggataccatacgg
gaacctcggttcagccagaatgctaacctaaggcctccaacccagccctcagaacagctg
gtgtggagggcagcccgcagcagtggggcagcccccacctacttccggcccaatgggcgc
ttcctggatggtgggctgctggccaacaaccccacgctggacgccatgactgagatacac
gagtacaaccaggacatgattcgcaagggtcagggccacaaggtgaagaaactctccatc
gtcgtctccctggggacagggaggtccccacaggtacccgtgacctgcgtggatgtcttc
cgtcccagcaacccctgggaactggccaagactgtttttggggccaaggaactgggcaag
atggtggtggactgttgcacggatccggacgggcgggcagtggaccgggcgcgggcgtgg
tgcgagatggtcagcatccagtatttcagattgaacactcagctggggacggacatcatg
ctggacgaggtcagcgatctggtgatggtcaacgctctctgggagaccgaggtctacatc
tatgaacttgggcagaggacccacagagggcgccgcctcggccctcaaggccaggcctga

KEGG   Loxodonta africana (African savanna elephant): 100667057
Entry
100667057         CDS       T04351                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04072  Phospholipase D signaling pathway
lav04217  Necroptosis
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04611  Platelet activation
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04921  Oxytocin signaling pathway
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100667057 (PLA2G4E)
   00565 Ether lipid metabolism
    100667057 (PLA2G4E)
   00590 Arachidonic acid metabolism
    100667057 (PLA2G4E)
   00591 Linoleic acid metabolism
    100667057 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    100667057 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100667057 (PLA2G4E)
   04014 Ras signaling pathway
    100667057 (PLA2G4E)
   04370 VEGF signaling pathway
    100667057 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    100667057 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100667057 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100667057 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    100667057 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    100667057 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100667057 (PLA2G4E)
   04913 Ovarian steroidogenesis
    100667057 (PLA2G4E)
   04921 Oxytocin signaling pathway
    100667057 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100667057 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    100667057 (PLA2G4E)
   04726 Serotonergic synapse
    100667057 (PLA2G4E)
   04730 Long-term depression
    100667057 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100667057 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100667057 (PLA2G4E)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100667057 (PLA2G4E)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2
Other DBs
NCBI-GeneID: 100667057
NCBI-ProteinID: XP_023414478
LinkDB
Position
Unknown
AA seq 834 aa
MLQRKMPAWVSHDLPDPCTAKDSRPSTTCAPEEGLSPCHLLTVRVIRMKNVRQADVLSQT
DCFVTLWLPTASCEKLRTKTISNCSNPEWNETFNFQIQSQVKNILELSVCDEDTVTPDDH
LLTVLYDLTKLCFRKKTHVKFPLNPEGMEELEVEFLLEESPSAPETLITNGVLVSRQISH
LEVHAEARRQRKSRKKEGLLVTVHESFEHTQHLLPCLEPCHPDPACFHYPKYFQPRICVE
VPKSHWSCGLCCCRARKSSPVCQPLDCLPDGHIMTLPVGENCELHMKSTDCPDVLDVRLG
YSLCPAELEFLEKRKVVVARALKQVLQLEEDLQADEVPLIAIMATGGGTRSMTSMYGHLL
GLQKLNILNCAAYIAGLSGATWTMATLYQDPEWSSKNLEPAVFEARRHVVKDKLPALFPD
QLLKYKEELRQRSQEGYRVTFNDFWGLLIEACLGDKRNECKLSEQRAALCRGQNPLPIYL
TINVKDDVSNQDFREWCEFSPYEVGLQKYGAFVPTELFGSEFFMGRLTKRIPESQMCYML
GLWSSIFSLNLLDAWNLSHTSEEFFHRWTRERVHDIEDEPLLPEIPKCDANALETTVVIP
GSWLSNTFRDILTHRSFVSEFHNFLRGLQLHTDYLQNGQFSKWKDTVLDGFPNQLTESVN
HLCLLDTAFFVNSCYPPLLRPERKADLIIHLNYCAGSQTKPMKQTCEYCTVQNIPFPRYE
LQEDDDHLKECYLMENPQDPEAPIVAFFPLINGTFQKYKAPGVERSPEELEHGQVDIYGP
KTPYATKELTYTEAAFDKLVKLSEYNILNNSDKLLQALRLAVEKKKRLKGQCPS
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgctccagaggaagatgcccgcctgggtctcccacgacctgccagacccatgcacagca
aaagacagcagaccctcaaccacctgtgccccagaggagggactgtctccatgccacctg
ctgacagtgagggtcatccggatgaaaaatgtccgtcaggctgacgtgttgagccagaca
gactgctttgtgaccctctggctgcccacagcctcttgtgaaaagctgaggactaagacg
atctccaactgctcaaacccagagtggaatgaaaccttcaacttccagatccagagccaa
gtgaagaacattttagagctgagcgtctgtgatgaagacacagtgacgccagacgaccat
ctcttgacagttctctatgacctcaccaagctctgcttccgaaagaaaacccacgtgaaa
ttcccacttaaccctgagggcatggaggagctggaggtagagttcctgctggaggagagt
ccctctgcacctgagaccctcatcaccaacggtgtcctggtgtcccggcaaatctcccat
ttggaggtacacgcagaagccaggcgtcagaggaagagcaggaaaaaggagggcctcttg
gtgacggtgcacgagtcctttgaacacacccagcacctcttgccctgcctggagccctgc
cacccagaccctgcctgcttccactaccccaagtacttccagccccggatatgtgtggag
gtgcccaagagccactggagctgtgggctttgctgctgcagagcccgcaagagcagccct
gtctgccagcccctggactgccttcccgatggccatatcatgaccctgcctgtgggtgag
aactgtgaattacacatgaagtctacagactgccccgacgtgctggacgtgcggctgggc
tacagcctgtgcccggcagagctggagttcctggagaagcggaaggtggtggtagctcgg
gcgctgaagcaggtgctgcagctggaggaggacctgcaggcagatgaggtaccgctgata
gccatcatggccaccgggggagggacaagatccatgacctccatgtacggccacctgctg
gggctgcagaagctgaacatcctgaactgtgccgcctatatcgccggcctgtcaggggcc
acctggaccatggctaccttgtaccaagaccccgaatggtcctccaaaaacctggagcct
gctgtcttcgaggcccggaggcatgtagtcaaggacaagctaccagctctgttcccagac
cagctccttaaatacaaggaggaactccggcagcgtagccaggaaggctacagggtcacc
tttaatgacttctggggcctgctgatcgaggcctgtctgggagacaagagaaacgaatgc
aaactgtcagagcagcgagccgctctgtgccgaggccagaaccccctgcccatctacctc
accatcaatgtcaaggatgatgtaagcaaccaagacttcagagagtggtgtgagttctcc
ccctacgaggtgggcctgcagaagtacggggccttcgtccccaccgagctcttcggctcc
gagttcttcatggggcggctgacgaagaggatccctgagtcgcaaatgtgctacatgcta
ggtttgtggagcagcatcttctccctgaacctgctggatgcctggaacctgtcccatacc
tcggaggagtttttccacaggtggacgagagagagagtgcatgatattgaagacgagccg
ctcctgcctgaaatccccaaatgtgacgccaacgccctggagaccacggtggtgatccca
gggtcatggctgtccaacactttccgcgacatcctcacccatcggtcctttgtgtctgag
ttccacaacttcctgagggggctgcagctgcacaccgactacctccagaacggccagttc
tccaagtggaaagacacagttctcgacggcttcccaaaccagctgacggagtccgtgaac
cacttgtgcctgctggacactgcgttctttgtcaactcctgctacccaccccttctacgg
ccagagaggaaagctgacctcatcatccacctcaattactgtgccgggtcccagaccaag
cccatgaagcaaacctgtgagtactgcaccgtgcagaacatccccttccccagatatgag
ctgcaagaagacgacgaccatctcaaggaatgctacctgatggagaacccccaggacccc
gaagcccccattgtggctttcttcccgctcatcaatggcaccttccaaaagtacaaggcc
ccaggtgtggagcgaagccctgaagagctggagcatggccaggttgacatttatggtccc
aaaactccctacgccaccaaggagctgacatacacagaagccgcctttgacaagctggtg
aagctgtctgagtacaacatcctgaacaacagcgacaagctccttcaggccctgcgactg
gcggtggagaagaagaaacgcctgaagggccagtgtccctcctga

KEGG   Loxodonta africana (African savanna elephant): 100670906
Entry
100670906         CDS       T04351                                 

Gene name
PLA2G2C
Definition
(RefSeq) putative inactive group IIC secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100670906 (PLA2G2C)
   00565 Ether lipid metabolism
    100670906 (PLA2G2C)
   00590 Arachidonic acid metabolism
    100670906 (PLA2G2C)
   00591 Linoleic acid metabolism
    100670906 (PLA2G2C)
   00592 alpha-Linolenic acid metabolism
    100670906 (PLA2G2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100670906 (PLA2G2C)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100670906 (PLA2G2C)
  09154 Digestive system
   04972 Pancreatic secretion
    100670906 (PLA2G2C)
   04975 Fat digestion and absorption
    100670906 (PLA2G2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100670906 (PLA2G2C)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100670906 (PLA2G2C)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100670906 (PLA2G2C)
SSDB
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2
Other DBs
NCBI-GeneID: 100670906
NCBI-ProteinID: XP_010591345
LinkDB
Position
Unknown
AA seq 152 aa
MKVIAVLVVFVSCLMAPTQSSFWQFQRMVKHVTGRSAFFSYYGYGCYCGLGGKGTPVDDT
DRCCLAHDCCYEKLKQLSCQPVLNSYQFDIVNGTVACRCAVGPGVGCLCGLKACECDKQS
VYCFRESLPTYEKNFKQFFSSRPRCGRRKLRC
NT seq 459 nt   +upstreamnt  +downstreamnt
atgaaggtcatcgccgttctcgttgtctttgtctcctgcttgatggctcccacccagagc
agcttctggcagtttcaaaggatggtcaaacatgtcacagggcggagtgccttcttctcc
tattatggatatggctgctactgtgggcttgggggcaaagggacccctgtggacgacact
gacaggtgctgcctggcacacgactgctgctatgagaagctgaaacagctcagctgccag
cccgtgttgaacagctaccagttcgacatcgtcaacggcaccgtggcctgtagatgtgcc
gtgggccctggtgttggctgcctctgtgggctgaaggcctgcgaatgtgacaagcaatct
gtgtactgcttcagagagagcctgcccacctatgagaaaaacttcaagcagttcttctcc
agccggccccgatgcggcaggcgcaagctccggtgctag

KEGG   Loxodonta africana (African savanna elephant): 100671190
Entry
100671190         CDS       T04351                                 

Gene name
PLA2G2F
Definition
(RefSeq) group IIF secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100671190 (PLA2G2F)
   00565 Ether lipid metabolism
    100671190 (PLA2G2F)
   00590 Arachidonic acid metabolism
    100671190 (PLA2G2F)
   00591 Linoleic acid metabolism
    100671190 (PLA2G2F)
   00592 alpha-Linolenic acid metabolism
    100671190 (PLA2G2F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100671190 (PLA2G2F)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100671190 (PLA2G2F)
  09154 Digestive system
   04972 Pancreatic secretion
    100671190 (PLA2G2F)
   04975 Fat digestion and absorption
    100671190 (PLA2G2F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100671190 (PLA2G2F)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100671190 (PLA2G2F)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100671190 (PLA2G2F)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Other DBs
NCBI-GeneID: 100671190
NCBI-ProteinID: XP_010591346
LinkDB
Position
Unknown
AA seq 167 aa
MKELFTIAILASSVLSVAQGSLFNLKSMVEALTGRHAIWTFVGYGCYCGLGGRGLPMDGV
DWCCHAHDCCYQKLFDLGCHPYVDPYEHTIENNTIVCSELNQTECDKQACECDKSITLCL
LNQSYNETYRNYLNVYCQGPAPNCSIYEPPPEEVTCRHISPGPPVPP
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaaggagctcttcaccattgccattctggccagcagcgttctgtccgtggcccagggc
agcctgttcaacctcaagtccatggtggaagccctcacggggagacacgccatctggacc
ttcgtgggttatggctgctactgcggactaggtgggcgaggcctgcctatggatggggtg
gactggtgctgccatgcccacgactgctgctaccagaagctctttgacctgggctgccac
ccctacgtggacccttatgaacacaccattgagaataatacaattgtctgcagcgagctc
aaccagacagagtgtgacaagcaggcatgtgaatgtgacaagagcatcactctgtgcctc
ctgaaccagtcgtacaacgagacgtatcgcaactacctcaatgtctactgccagggcccc
gcacccaactgcagcatctatgagccaccccctgaggaggtcacctgcagacacatctcc
ccaggacctccggtgcctccctag

KEGG   Loxodonta africana (African savanna elephant): 100671475
Entry
100671475         CDS       T04351                                 

Gene name
PLA2G2D
Definition
(RefSeq) group IID secretory phospholipase A2 isoform X1
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100671475 (PLA2G2D)
   00565 Ether lipid metabolism
    100671475 (PLA2G2D)
   00590 Arachidonic acid metabolism
    100671475 (PLA2G2D)
   00591 Linoleic acid metabolism
    100671475 (PLA2G2D)
   00592 alpha-Linolenic acid metabolism
    100671475 (PLA2G2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100671475 (PLA2G2D)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100671475 (PLA2G2D)
  09154 Digestive system
   04972 Pancreatic secretion
    100671475 (PLA2G2D)
   04975 Fat digestion and absorption
    100671475 (PLA2G2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100671475 (PLA2G2D)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100671475 (PLA2G2D)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100671475 (PLA2G2D)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 100671475
NCBI-ProteinID: XP_003413168
LinkDB
Position
Unknown
AA seq 152 aa
MKLPLLCVLLVISGVIPTQSGTLNLNKMIKQVTGKIPFFTYWFYGCHCGPGGKGHPKDAT
DWCCRAHDCCYALLKNERCRFHTDNYRYDFLEGEIQCSDKGSWCEKQLCACDKTMALCLQ
ESLHTYNKRLRYYWRPRCQGQSPECWERSAMK
NT seq 459 nt   +upstreamnt  +downstreamnt
atgaaacttcccctgctgtgtgtgctgctggtgatctctggtgtgattccaacccagagc
gggaccctgaacctgaacaagatgatcaaacaagtaaccgggaagatacccttcttcacc
tattggttctatggctgtcactgcggacctggtggcaaaggccaccccaaagatgccaca
gactggtgctgcagggcccatgactgttgctacgccctcttgaagaacgaaagatgccgt
ttccacacggacaattacagatacgacttcctcgaaggggaaatccagtgctcggacaag
gggagctggtgtgagaagcagctgtgcgcctgtgacaagacgatggccttgtgcctgcag
gaaagcctacacacttacaataagcgcctgcgttactactggcggccccgttgccagggc
cagagcccagagtgctgggagaggtccgccatgaagtga

KEGG   Loxodonta africana (African savanna elephant): 100671761
Entry
100671761         CDS       T04351                                 

Gene name
PLA2G5
Definition
(RefSeq) calcium-dependent phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100671761 (PLA2G5)
   00565 Ether lipid metabolism
    100671761 (PLA2G5)
   00590 Arachidonic acid metabolism
    100671761 (PLA2G5)
   00591 Linoleic acid metabolism
    100671761 (PLA2G5)
   00592 alpha-Linolenic acid metabolism
    100671761 (PLA2G5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100671761 (PLA2G5)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100671761 (PLA2G5)
  09154 Digestive system
   04972 Pancreatic secretion
    100671761 (PLA2G5)
   04975 Fat digestion and absorption
    100671761 (PLA2G5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100671761 (PLA2G5)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100671761 (PLA2G5)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100671761 (PLA2G5)
SSDB
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2
Other DBs
NCBI-GeneID: 100671761
NCBI-ProteinID: XP_003413169
LinkDB
Position
Unknown
AA seq 111 aa
MIETITGKNALLNYGFYGCYCGLGGQGTPKDGTDWCCWVHDHCYGLLEEKGCNIVTQSYK
YKVTWGSVTCELGPFCQVHLCACDRKLVYCLRRKLRSYDSSYQYFPRVFCS
NT seq 336 nt   +upstreamnt  +downstreamnt
atgattgagacgataactggaaagaatgccctgctgaactatggtttctatggctgctac
tgtggcttgggtggccaagggacccccaaagatggcactgattggtgctgttgggtgcat
gaccactgctacgggcttctggaggagaaaggctgcaacatcgttacccagtcatacaag
tacaaagtcacatggggctcggtcacctgtgagctcgggcccttctgccaggtgcatctc
tgtgcctgtgaccggaagcttgtctactgcctccggagaaaactaaggagctacgactcc
agctaccaatactttccccgggtcttctgctcctag

KEGG   Loxodonta africana (African savanna elephant): 100672052
Entry
100672052         CDS       T04351                                 

Definition
(RefSeq) phospholipase A2, membrane associated-like
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100672052
   00565 Ether lipid metabolism
    100672052
   00590 Arachidonic acid metabolism
    100672052
   00591 Linoleic acid metabolism
    100672052
   00592 alpha-Linolenic acid metabolism
    100672052
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100672052
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100672052
  09154 Digestive system
   04972 Pancreatic secretion
    100672052
   04975 Fat digestion and absorption
    100672052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100672052
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100672052
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100672052
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 100672052
NCBI-ProteinID: XP_003413170
LinkDB
Position
Unknown
AA seq 144 aa
MKTLLLLVVIMALGLLQVQGSLLDFRKMIRLVTGKEPISSYGFYGCHCGVGGKGSPKDAT
DRCCAEHDCCYKRLEKRRCGTKFLNYKFTKSGSQIVCAKQDFCKSQLCQCDRNAAYCFAR
NQKTYNKKFQYYSNGQCSGKTPSC
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaagaccctcctgctgttggtagtaatcatggccttgggcctgctgcaagtccagggg
agtttactggatttccgaaaaatgatccggttggtgacaggaaaggaacctatatccagc
tatggtttctatggttgccactgtggtgttggtggtaaaggatcccccaaagatgcgaca
gatcggtgctgcgctgaacacgactgctgctataaacgtctggagaaacgtaggtgtggc
accaaattcctgaattacaagtttaccaagagtggaagccaaattgtctgtgcaaaacag
gacttctgcaagagccagctgtgtcaatgtgatagaaatgctgcctactgttttgcaaga
aaccagaagacctataataaaaagttccagtactactccaatgggcagtgcagtgggaag
acccccagctgctga

KEGG   Loxodonta africana (African savanna elephant): 100672344
Entry
100672344         CDS       T04351                                 

Definition
(RefSeq) phospholipase A2, membrane associated-like
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100672344
   00565 Ether lipid metabolism
    100672344
   00590 Arachidonic acid metabolism
    100672344
   00591 Linoleic acid metabolism
    100672344
   00592 alpha-Linolenic acid metabolism
    100672344
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100672344
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100672344
  09154 Digestive system
   04972 Pancreatic secretion
    100672344
   04975 Fat digestion and absorption
    100672344
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100672344
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100672344
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100672344
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N PRY
Other DBs
NCBI-GeneID: 100672344
NCBI-ProteinID: XP_023407677
LinkDB
Position
Unknown
AA seq 117 aa
MIRLVTGKEAASSYGFYGCYCGLGGKGSPKDATDWCCAEHDCCYKRLEKHGCGTKLLSYQ
FTYRGGQIICAKQGFCRSQLCECDRKAAYCFAKNRKTYKKRFKYYPNVLCSGSAPRC
NT seq 354 nt   +upstreamnt  +downstreamnt
atgatccgtttggtgacaggaaaggaagctgcgtccagctatggtttctatggttgctac
tgtggccttggcggcaaaggatcccccaaggatgcaacagattggtgctgcgctgaacac
gactgctgctataaacgtctggagaaacatgggtgtggcaccaaacttctgagctaccag
tttacttaccgtgggggccaaatcatctgtgcgaaacagggcttctgcaggagtcagctg
tgtgaatgcgatagaaaggctgcctactgttttgcaaaaaaccggaagacctataagaaa
agattcaaatactaccccaatgtgctgtgcagtgggagcgccccccgttgctga

KEGG   Loxodonta africana (African savanna elephant): 100672917
Entry
100672917         CDS       T04351                                 

Gene name
PLA2G2E
Definition
(RefSeq) group IIE secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100672917 (PLA2G2E)
   00565 Ether lipid metabolism
    100672917 (PLA2G2E)
   00590 Arachidonic acid metabolism
    100672917 (PLA2G2E)
   00591 Linoleic acid metabolism
    100672917 (PLA2G2E)
   00592 alpha-Linolenic acid metabolism
    100672917 (PLA2G2E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100672917 (PLA2G2E)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100672917 (PLA2G2E)
  09154 Digestive system
   04972 Pancreatic secretion
    100672917 (PLA2G2E)
   04975 Fat digestion and absorption
    100672917 (PLA2G2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100672917 (PLA2G2E)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100672917 (PLA2G2E)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100672917 (PLA2G2E)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 100672917
NCBI-ProteinID: XP_023407753
LinkDB
Position
Unknown
AA seq 145 aa
MLLVPRVWRPQLSLPVVPLARGNLVQFGVMIERMTGKPALHYNNYGCYCGIGGAHWPVDQ
TDWCCHAHDCCYGHLEKLGCEPKLEKYLFSTSRCNIFCAGRTACQRQTCMCDKRAALCFR
HNLDTYNRKYAHYPKKLCTGPTPPC
NT seq 438 nt   +upstreamnt  +downstreamnt
atgctcctggtcccgagggtctggcggcctcagctctcgctccccgtagtgcccctggcc
agagggaacctggtgcagtttggggtgatgattgagaggatgacagggaagcccgcactg
cattacaacaactacggctgctactgtggcatcggcggtgcccactggcctgtggaccag
accgactggtgctgccatgcccacgactgctgctacgggcacctggagaaactgggctgt
gaacccaaactggaaaagtatctgttctccaccagcaggtgcaacatcttctgtgccggc
agaaccgcctgccagcggcagacctgcatgtgtgacaagagggctgcactctgctttcgg
cacaacctggacacctacaaccgcaaatatgcccactaccccaagaagctgtgcaccgga
cccaccccaccctgctaa

KEGG   Loxodonta africana (African savanna elephant): 100675131
Entry
100675131         CDS       T04351                                 

Gene name
PLA2G4D
Definition
(RefSeq) LOW QUALITY PROTEIN: cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04072  Phospholipase D signaling pathway
lav04217  Necroptosis
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04611  Platelet activation
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04921  Oxytocin signaling pathway
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100675131 (PLA2G4D)
   00565 Ether lipid metabolism
    100675131 (PLA2G4D)
   00590 Arachidonic acid metabolism
    100675131 (PLA2G4D)
   00591 Linoleic acid metabolism
    100675131 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    100675131 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100675131 (PLA2G4D)
   04014 Ras signaling pathway
    100675131 (PLA2G4D)
   04370 VEGF signaling pathway
    100675131 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    100675131 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100675131 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100675131 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    100675131 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    100675131 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100675131 (PLA2G4D)
   04913 Ovarian steroidogenesis
    100675131 (PLA2G4D)
   04921 Oxytocin signaling pathway
    100675131 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100675131 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    100675131 (PLA2G4D)
   04726 Serotonergic synapse
    100675131 (PLA2G4D)
   04730 Long-term depression
    100675131 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100675131 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100675131 (PLA2G4D)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100675131 (PLA2G4D)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 100675131
NCBI-ProteinID: XP_003418804
LinkDB
Position
Unknown
AA seq 824 aa
MGQQTSSQLGAKTQEREDAGNQGRRETSPCWRLTVKVLEARNLPWADLLSEADPYVILQL
PTVPGTKFKTKTVTNSNNPVWNETFTFRIQSQVKNVLELSIYDEDSIKKDDLFFKFLYDV
SEVLPGRLLQKTFSWDPQVELDVEFLVEKTLDHPENLTTNNVLVARELSCLNVHLDSTGS
MAVAPDQDKLELELVLKGSYEDTQTVTLGKASAFCFHYMAAQETELSGRLRGSTSSGWNT
DISAEPLTVPLQSLTVGKKVTIDLPVPNASEVRLQLKAEGCPEELAVQLGFDLCAEEQAF
LSKRKQVVARALQQALQLEGNLQEDEVPIVGIMATGGGARAMTSLYGHLLALQKLGLLDC
VTYLSGISGSTWTMAHLYGNPEWSQQDLEGPILYAREHMAKSKLETFSPECLSSYLEELK
LRSEQGYPTTFVDLWALVLENMLHGQKMHQTLSGQKAALQQGQNPLPLYLSLNVKENHLE
TLDFKEWVEFSPYEIGFLKYGAFIPSELLGSDFFMGRLMRKLPESRICFLEGIWSNIVSL
NLLDLWHGLTSSGEAWKQHIRDKMRSMEEPPASSETSSYLEASWLQPGTALAQAFKDFLI
NRPLYQCSPNFLHGXQLHQDYYHQKDFSTWADCQLDGTPSQLTLQETQLCLVDSGYFINT
SCPSMFRPGRKLDLILFFDYSLSSSFEVLQQTELYCRAHGLPFPRVELNPQELRQTGECY
LFSDPDRPEAPVLLYFPLVNASFKDHSAPGVQRSSAELQTGQVDLTRATSPYSTFNMTYK
EEDFDRLLHLSDYNVRNSQDTILQALRMALKHHASANRPPEVQT
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgggacaacagacctcttcccagctcggcgccaagacacaggagagggaagatgcaggc
aaccaggggagaagggagacctctccctgctggcggctcacagtgaaggtcctggaggca
cggaacctgccctgggctgacctgttgagcgaggctgatccgtatgtgatccttcagctg
ccaactgtacccggaacaaagtttaagaccaagacggtcaccaactccaacaaccctgta
tggaatgagaccttcaccttccgaatccagagtcaggtcaagaatgttctggagctgagc
atctacgatgaagactctattaaaaaggatgatctcttcttcaagtttctctatgatgtc
tcagaagttctccctggcaggctgctccagaagaccttctcctgggatcctcaggtggag
ctggacgttgagttcctggtggagaaaacgttggaccacccagaaaacctcaccaccaac
aacgtccttgtggcccgggagctgtcgtgcctgaacgtgcatctggacagcacagggagc
atggccgtggccccagatcaggacaaactggagctggagctggtgctgaaggggtcatac
gaggatacacagacagtgaccctgggcaaagcctctgccttctgcttccactacatggca
gcccaggagacagagctgagtgggcgcctgcggggctctacaagcagtggctggaacaca
gacatctcagctgagcccctcactgtgcccctgcagtccttgaccgtggggaagaaggtg
accattgatcttcctgtcccaaatgcttcagaagtgaggcttcagctcaaggcagagggc
tgccccgaggagctggctgtgcagctgggcttcgacctgtgtgcagaggagcaagccttc
ctgagcaagaggaagcaggtggtggccagggccctgcagcaggccctgcagctggagggc
aacctgcaggaggatgaggtccccatcgtgggcataatggccaccggagggggtgcccgg
gccatgacctcactctacggccacctgttggccctgcagaagctgggtctcctggactgc
gtgacctacctcagtggcatctcaggctctacatggacaatggcccacctgtacgggaac
cctgagtggtcacagcaggaccttgagggacccatcctatatgcccgagagcacatggcc
aagagcaagctggagaccttctccccagaatgcctgagcagctacctggaggagctgaag
ctgcggtctgagcagggctaccccaccacctttgtggacctgtgggccctagtgttggag
aacatgctgcatggccagaagatgcatcagacgctgtcaggacagaaagctgctctgcag
cagggccagaaccctctgccactctacctgagcctcaatgtcaaagagaaccatctggag
accctcgacttcaaggagtgggtcgagttctccccctatgagattgggttcttgaagtat
ggggccttcatcccctctgagctcttgggctctgacttcttcatggggcggctgatgagg
aagctccctgagtcccggatctgctttcttgaaggtatctggagcaacattgtctccctg
aacttgctggatctctggcatggcctcaccagctccggggaagcctggaaacagcacatc
cgggacaagatgaggagcatggaggagccccctgcctcctcagagacctcctcataccta
gaggcctcgtggctgcagcctggaacggcactggcccaagccttcaaggacttcctgata
aacaggccgctctaccagtgcagccccaacttcctccatggcntccagctgcaccaggac
tactaccaccagaaagacttctctacctgggcagactgccagctggatggcacccccagc
cagctgaccctccaggagacacagctctgcctggtggacagtggctacttcatcaacacc
agctgcccctccatgttccgaccaggccgcaagctggacctcatcctcttctttgactac
tccttgtcctcatcctttgaggtgctgcagcagactgagctgtactgccgggcccatggg
ctgcccttcccccgcgtggagctgaaccctcaggaacttcgccagaccggggagtgctac
ctcttctccgaccctgaccgccctgaggcccctgtcctgctctacttcccgctggttaac
gcctccttcaaggaccactcggcccctggtgtccagcgcagctctgcagagctccagact
ggccaagtggatctcaccagggccacctcaccctattccacgttcaacatgacgtacaag
gaggaagactttgaccgcctgctgcacctcagtgactacaatgtgcggaacagccaggac
accatcctgcaggccttgagaatggcactgaagcaccatgcctcggcgaacaggcctcca
gaggtgcagacatga

KEGG   Loxodonta africana (African savanna elephant): 100675231
Entry
100675231         CDS       T04351                                 

Gene name
PLA2G1B
Definition
(RefSeq) phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100675231 (PLA2G1B)
   00565 Ether lipid metabolism
    100675231 (PLA2G1B)
   00590 Arachidonic acid metabolism
    100675231 (PLA2G1B)
   00591 Linoleic acid metabolism
    100675231 (PLA2G1B)
   00592 alpha-Linolenic acid metabolism
    100675231 (PLA2G1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100675231 (PLA2G1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100675231 (PLA2G1B)
  09154 Digestive system
   04972 Pancreatic secretion
    100675231 (PLA2G1B)
   04975 Fat digestion and absorption
    100675231 (PLA2G1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100675231 (PLA2G1B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100675231 (PLA2G1B)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100675231 (PLA2G1B)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Other DBs
NCBI-GeneID: 100675231
NCBI-ProteinID: XP_023415272
LinkDB
Position
Unknown
AA seq 145 aa
TLAVSLLAVGAAGSGISPRAVWQFRNMIKCAIPNSNPLKEYNDYGCYCGLGGSGTPVDEL
DTCCQTHDQCYDRVKNLSSCTFLLDNPYTNNYSYKCSGSDITCSSSNEECEAVLCNCDRS
AAICFSKAPYNEEHKSLDKKKYCQS
NT seq 438 nt   +upstreamnt  +downstreamnt
actctggctgtgtctctccttgcagtgggtgctgctgggagtggcatcagcccgcgagca
gtatggcagttccgcaacatgatcaagtgcgcgatccccaacagtaatcccttgaaagaa
tacaacgactacggctgctactgcggcctgggcggatcaggcacccctgtggacgaattg
gacacgtgctgtcagacacacgaccaatgctacgaccgggttaagaatctgagtagctgt
acattcctcctggacaacccctacaccaataactactcatacaaatgctctggatctgat
atcacctgcagcagcagcaacgaagagtgtgaggccgtcctctgcaactgtgaccgcagt
gctgccatctgcttttcaaaggccccatacaacgaggagcacaagagcctggacaaaaag
aagtactgtcagagctga

KEGG   Loxodonta africana (African savanna elephant): 100675410
Entry
100675410         CDS       T04351                                 

Gene name
PLA2G4F
Definition
(RefSeq) LOW QUALITY PROTEIN: cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04072  Phospholipase D signaling pathway
lav04217  Necroptosis
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04611  Platelet activation
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04921  Oxytocin signaling pathway
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100675410 (PLA2G4F)
   00565 Ether lipid metabolism
    100675410 (PLA2G4F)
   00590 Arachidonic acid metabolism
    100675410 (PLA2G4F)
   00591 Linoleic acid metabolism
    100675410 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    100675410 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100675410 (PLA2G4F)
   04014 Ras signaling pathway
    100675410 (PLA2G4F)
   04370 VEGF signaling pathway
    100675410 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    100675410 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100675410 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100675410 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    100675410 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    100675410 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100675410 (PLA2G4F)
   04913 Ovarian steroidogenesis
    100675410 (PLA2G4F)
   04921 Oxytocin signaling pathway
    100675410 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100675410 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    100675410 (PLA2G4F)
   04726 Serotonergic synapse
    100675410 (PLA2G4F)
   04730 Long-term depression
    100675410 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100675410 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100675410 (PLA2G4F)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100675410 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 100675410
NCBI-ProteinID: XP_003418805
LinkDB
Position
Unknown
AA seq 849 aa
MLWALWPRWLAGRGLPLLGAVLLRKREKKGPQWRHWQQETHPYYDLQVKVLRARNIRDTD
LLSKADCYVQLWLPTASPSTAQTKTVANCSDPEWNETFHYQVHGAVKNVLELTLYDKDVL
GSDRLSLLLFDLRSLKPGQPHRHTFSLNHKDSQELQVEFVLEESQVPASEVITNGVLVAQ
PCLRIQGTLGEHGTALHREYGHRHIQLAVPGAYEKPQLLPLQPAVELGFPPTFTFHVNPV
LSSRLDVELGEKLTILQSGPSAELESQASNLGEGSILLSSLPLGQEEQCFVALGEGQEVA
LSVKAEMSSGDLDLRLGFDLCDGEQEFLDKRKQVVSKGLQQVLGLSGAPDSDQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGFLDTVTYLSGVSGSTWCMSTLYSDPAWSHVALQGPIE
RAQARVCSSKMGAVSTERLQYYAQELGARESSGHSVSLIDLWGLLVEYFLYQEENPAKLS
DQQEAVSQGQNPYPIYASVNVRTNISGEDFAGTWVHPYEVGFPKYGAYVPTELFGSVVFM
GRLMWSRPEPRICYLQGMWGSAFAASLNEIFLKTTGSGLSFLDSYRGSVNIMDDSQKLWL
HDSSQLHTRLFTPQGPFSQAVLDLFTSRFTSAENFNFTRGLCLHKDYVACREFMAWKDSH
PDAFPNQLTPMRDCLCLVDGGFAINSPFPLALLPQRAVDLILSFDYSLDAPFEVLQMTEK
YCLDRGIPFPKIVVCPGDLEEPRECYLFTNAEDPRSPIVLHFPLVNHSFRTHLAPGVERQ
TAEEKAFGDFVVNRPDTPYGMMNFTYEPQVFARLVALSRYNVLNNAETVRHALRLALDRR
QQAGERAGG
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgctctgggcactctggccaaggtggctggcgggcagggggctgcccctcttgggggca
gtgctgctgcggaagagagagaagaaaggacctcagtggagacactggcagcaggaaacc
cacccatactatgacctccaggtgaaggtgctgagggccaggaacatccgggacacagac
ctgctgtccaaagctgactgctatgtgcaactctggctacccacagcgtcccccagcacc
gcccagacaaagacggtggccaactgcagtgacccggagtggaatgagaccttccactac
caggtccatggtgctgtgaagaacgtcctggagctcaccctctatgacaaggatgtcctg
ggcagtgaccgactctccctgctcctgtttgacctgaggagcctcaagccaggccaaccg
cacaggcacaccttctcactcaaccacaaggattcacaagagctgcaagtggaatttgtt
ctggaggagagccaggtgcctgcgtctgaagtcatcaccaatggggtcctggtggctcag
ccctgtctgagaatccagggcacccttggggaacatggaacagccctacatcgagagtat
ggccatcggcacatccagctggcagtgcctggcgcctacgagaagccacagctcttgcct
ctgcagcctgctgtggagctgggcttcccgcccacttttaccttccacgtgaacccagtg
ctaagctccaggctggatgtggagctgggagagaagctcaccatcctgcagagcggcccg
agtgctgagctggagtcccaggccagcaatctgggcgaggggagtatcctgctctcctct
ttgcccctaggccaggaggagcagtgcttcgtggccctgggggagggccaggaggtggcg
ctgagtgtgaaggcagaaatgagctctggggaccttgacctgcgccttggctttgacctc
tgtgacggggagcaggagtttctggacaagaggaagcaggtggtgtccaagggcctgcag
caggtgctgggactcagtggggctccagacagtgaccaggtgcctgtggtggctgtgctg
ggttctgggggtggaacacgagccatgtcttccctgtacggcagcctggcagggctgcag
gagctgggcttcctggacactgtaacctacctcagtggtgtctctgggtccacctggtgc
atgtccaccctctacagtgacccagcctggtcccacgtggccttgcagggccccattgag
cgtgcccaggcccgagtctgcagcagcaagatgggggcagtgtccacagagcggctgcag
tactatgcccaggaactgggagcccgtgaaagcagcggccacagcgtttccctcatcgac
ctgtggggcctccttgtggagtatttcctgtaccaggaggaaaacccagccaagctgtct
gaccagcaggaggcagtcagccagggtcagaacccttaccccatttatgccagtgtcaac
gtccgcaccaacatcagtggggaagactttgcgggtacatgggttcacccttatgaggtc
ggcttccccaagtatggggcttatgtccccactgaactcttcggctctgtagttttcatg
gggcggctgatgtggtcccgtccagagccccggatctgctacctgcagggtatgtggggc
agcgcctttgcggccagcctgaatgagatcttcctgaagaccaccggctccggcctcagc
ttcctggactcgtacaggggcagcgtaaacatcatggatgactcgcagaagctctggctg
cacgactcctcccagttgcacacaaggctcttcaccccccaggggcccttctcccaggct
gtcctggacttgtttacctcccgctttacctctgcggagaactttaacttcacccggggc
ctctgcctacacaaggactatgtggcttgcagggagttcatggcctggaaagactcacac
ccagatgccttcccgaaccagctcacccccatgagggactgcctgtgcctggtggatggg
gggtttgccatcaactctccattcccactggctttactgcctcagagggctgtggacctc
atcctgtcctttgactactccttggatgctccttttgaggtcttacagatgacagagaag
tactgcctggaccggggaatccccttccccaagatcgtggtgtgtccgggggacttggag
gaaccccgcgagtgctatttgtttactaatgctgaggacccccgctcacccattgtgttg
cacttccccctcgtcaaccacagctttcgcacacacctggccccaggtgtggagcggcaa
acagctgaggagaaggccttcggggactttgtcgtcaacaggccagacaccccctatggc
atgatgaactttacctatgagccccaggtgtttgctcggctggtggccctgagtcgatac
aatgttctgaacaatgcagagaccgtgaggcatgctctccggctggctctggaccggcgg
cagcaggctggggagagggctgggggctga

KEGG   Loxodonta africana (African savanna elephant): 104846176
Entry
104846176         CDS       T04351                                 

Definition
(RefSeq) phospholipase A2, membrane associated-like
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104846176
   00565 Ether lipid metabolism
    104846176
   00590 Arachidonic acid metabolism
    104846176
   00591 Linoleic acid metabolism
    104846176
   00592 alpha-Linolenic acid metabolism
    104846176
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104846176
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104846176
  09154 Digestive system
   04972 Pancreatic secretion
    104846176
   04975 Fat digestion and absorption
    104846176
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    104846176
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     104846176
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    104846176
SSDB
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2
Other DBs
NCBI-GeneID: 104846176
NCBI-ProteinID: XP_023407679
LinkDB
Position
Unknown
AA seq 137 aa
MKTLLLLVVIMALGLLQVQGSLLDFRKMIRLVTGKEATSSYGFYGCHCGVGGKGSPKDAT
DRCCAEHDCCYKRLEKRRCGTKFLNYKFTKSGSQIVCGKTQFYDPTRFPYSVSTVLSTGL
GTRCRNTEGYCPCLKGS
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaagaccctcctgctgttggtagtaatcatggccttgggcctgctgcaagtccagggg
agtttactggatttccgaaaaatgatccggttggtaacaggaaaggaagctacatccagc
tatggtttctatggttgccactgtggtgttggtggcaaaggatcccccaaggatgcgaca
gatcggtgctgcgctgaacacgactgctgctataaacgtctggagaaacgtaggtgtggc
accaaatttctgaattacaagttcaccaagagtggaagccaaattgtctgtggtaagaca
cagttctacgaccccacacggtttccttattcagtgtccactgtgctgagtactgggctg
ggcaccagatgtagaaatacagagggatattgtccctgcctcaaaggctcatag

KEGG   Loxodonta africana (African savanna elephant): 111752704
Entry
111752704         CDS       T04351                                 

Gene name
PLA2G10
Definition
(RefSeq) group 10 secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04014  Ras signaling pathway
lav04270  Vascular smooth muscle contraction
lav04972  Pancreatic secretion
lav04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111752704 (PLA2G10)
   00565 Ether lipid metabolism
    111752704 (PLA2G10)
   00590 Arachidonic acid metabolism
    111752704 (PLA2G10)
   00591 Linoleic acid metabolism
    111752704 (PLA2G10)
   00592 alpha-Linolenic acid metabolism
    111752704 (PLA2G10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111752704 (PLA2G10)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111752704 (PLA2G10)
  09154 Digestive system
   04972 Pancreatic secretion
    111752704 (PLA2G10)
   04975 Fat digestion and absorption
    111752704 (PLA2G10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    111752704 (PLA2G10)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     111752704 (PLA2G10)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    111752704 (PLA2G10)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 111752704
NCBI-ProteinID: XP_023413094
LinkDB
Position
Unknown
AA seq 163 aa
MGPQLLCLPVMLLLLSLLPDLGPGPGAGEASRKSHVHRRGLLELAGTLECASTLSALAYI
SYGCHCGLGGQGRPRDTTDWCCHRHDCCYGLAEEAGCRPKLDRYSWKCTDNRVVCGPAED
KCQELLCKCDQEAAHCLARAEYNIQHLFYPYFLCEKDSPKCDY
NT seq 492 nt   +upstreamnt  +downstreamnt
atgggcccgcagcttctgtgcctgccagtaatgctgctcctgctgtcgctgctgccggac
ctcgggcccggacctggggcgggtgaggcctccaggaagtctcatgtgcaccggcgtggg
ctcctcgagctggcaggaaccctggagtgtgccagcaccctctctgccctggcctacata
agctatggttgccactgtggcctaggtggccaaggccggccccgggacaccacagactgg
tgctgccatcgccatgactgctgctatggactcgctgaggaggccggctgtaggcccaag
ctggaccgctactcctggaagtgcactgataatcgcgtggtgtgcggaccagcagaggac
aaatgccaagaactcctatgcaagtgtgaccaggaggctgctcactgcttagcccgagct
gagtacaacatacagcacctcttctacccctatttcttatgtgagaaagactcacccaag
tgtgactactag

KEGG   Loxodonta africana (African savanna elephant): 111753010
Entry
111753010         CDS       T04351                                 

Gene name
PLA2G4B
Definition
(RefSeq) cytosolic phospholipase A2 beta isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav00565  Ether lipid metabolism
lav00590  Arachidonic acid metabolism
lav00591  Linoleic acid metabolism
lav00592  alpha-Linolenic acid metabolism
lav01100  Metabolic pathways
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04072  Phospholipase D signaling pathway
lav04217  Necroptosis
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04611  Platelet activation
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04724  Glutamatergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04921  Oxytocin signaling pathway
lav05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111753010 (PLA2G4B)
   00565 Ether lipid metabolism
    111753010 (PLA2G4B)
   00590 Arachidonic acid metabolism
    111753010 (PLA2G4B)
   00591 Linoleic acid metabolism
    111753010 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    111753010 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111753010 (PLA2G4B)
   04014 Ras signaling pathway
    111753010 (PLA2G4B)
   04370 VEGF signaling pathway
    111753010 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    111753010 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111753010 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111753010 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    111753010 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    111753010 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    111753010 (PLA2G4B)
   04913 Ovarian steroidogenesis
    111753010 (PLA2G4B)
   04921 Oxytocin signaling pathway
    111753010 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111753010 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    111753010 (PLA2G4B)
   04726 Serotonergic synapse
    111753010 (PLA2G4B)
   04730 Long-term depression
    111753010 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111753010 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    111753010 (PLA2G4B)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     111753010 (PLA2G4B)
SSDB
Motif
Pfam: PLA2_B HRM
Other DBs
NCBI-GeneID: 111753010
NCBI-ProteinID: XP_023414467
LinkDB
Position
Unknown
AA seq 573 aa
MEMGSSLMRLSAASWSLPSCPRPGELAVRLGCGPCTEEQAFLSRRKQVVARALQQALQLE
GDLQEDEVPVVAVMATGGGIRAMTSLYGQLAGLRELGLLDCISYITGVSGSTWTLANLYE
DPEWSQKDLAGPIELLKTQVTKSKLGVLAPSQLQRYEQELTERARLGYPACFTNLWALIN
EALLHDGPYDHKLSDQREALRHGQNPLPIYCALNTKEQSLSTFEFGEWCEFSPYEVGFPK
YGAFIPAELFGSEFFMGRLMKQLPESRICFLEGLWTNLYAANLQDSLYWSSDPSQFWDRW
AQNQASLDKEQVPILKIEDPPSMTGRIAAFFTDLLTWRPLAQVTHNFLHGLHFHKDYFQH
PHFSTWKATKLDGLPNQLTPMEPHLCLLDVGYFVNTSCPPLLQPTRDVDLILSFDYNLQG
AFQQLQLVSRFCQEQGIPFPPVSPSPEEEYQPRECHEFSDPHRPEAPIILHFPLVNDSFR
EHSAPGVRRTPEEEEAGQVNLSPSDSPYHYTKVTYSQENVDKLLGLTYYNICNNRELLLA
ALREAMQRRRQRRLRGPSDSSLPGCPSGSVPPE
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggaaatgggatcttctctgatgaggctgagtgcggcctcatggtccctcccttcctgc
cccagaccaggggagctggctgtgcggctgggctgcgggccctgcaccgaggagcaggcc
ttcctgagcaggaggaagcaggtggtggccagggcactgcagcaggccctgcagctggag
ggcgacctgcaggaggacgaggtcccagtggtagctgttatggccactggtggagggatc
cgggcaatgacctccctatatgggcagttggctggcctgagggagctgggcctcttggat
tgcatctcttatatcacgggagtctcgggctccacctggaccttggccaacctctatgag
gatccagagtggtctcagaaggacctggctggacccattgagttgctaaagacccaggtg
accaagagcaagctgggcgtgctggcccccagccaactgcagcggtacgagcaggagctg
actgagcgagctcgcctgggctacccggcctgcttcaccaacctatgggccctcatcaac
gaggcgctgctgcacgacgggccctatgaccacaaactttcggatcagcgggaggccctg
cgtcacggccagaaccctctgcccatctactgtgccctcaacaccaaggagcagagcctg
tccacctttgaatttggggagtggtgtgagttctccccctacgaggtcggcttccccaag
tacggggccttcatccctgctgagctcttcggctctgagttcttcatgggacggttgatg
aagcagctccctgagtcccgcatctgtttcctggaaggtctctggaccaacctgtatgca
gccaacctccaggacagcttatactggtcctcagatcccagccagttctgggaccgctgg
gctcagaatcaggccagcctggacaaggagcaggtccccatcctgaagatagaagaccca
cctagcatgactggaaggatagcagcgtttttcactgacctcctgacttggcgcccactt
gcccaggtcacccacaacttcctgcatggcctccatttccacaaagactattttcagcac
cctcacttctccacctggaaagccaccaaactggacgggcttcctaaccagctgacaccc
atggagcctcacctttgcctgctggatgtcggctactttgtcaacaccagctgcccgccc
ctcctgcagcccacacgggatgtggacctcatcctttcatttgactacaacctccaagga
gcctttcagcagctgcagcttgtcagccggttctgccaggagcaggggatcccgttcccg
cctgtctccccgagcccggaggaggagtatcagcctcgggagtgccatgagttctcggac
ccccaccgccctgaggcccccatcatcctgcacttcccactggtcaacgactccttccgg
gagcactcggcccccggggtccggaggacaccggaggaggaggaggcagggcaggtgaac
ctatctccatccgactccccctaccactacacgaaggtgacctacagccaggagaacgtc
gacaagctgctcggcctgacgtactacaacatctgcaacaaccgtgagctgctcctggca
gccctgcgtgaggccatgcagcggagaaggcagcgcaggctgcgtggcccgagtgacagc
tcactgcctggctgccccagcggctctgtgccacccgagtga

DBGET integrated database retrieval system