KEGG   Loxodonta africana (African savanna elephant): 100656664
Entry
100656664         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: myosin-binding protein C, fast-type
  KO
K12568  myosin-binding protein C, cardiac-type
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100656664
   05414 Dilated cardiomyopathy
    100656664
SSDB
Motif
Pfam: fn3 I-set Ig_3 ig Ig_2 V-set Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 100656664
NCBI-ProteinID: XP_023399843
LinkDB
Position
Unknown
AA seq 543 aa
MVIHRLARSSEKSELPHVHVPSQAKQLEVLQDVADLTVKAAERAEFTCEVSDEKVFSATE
GRTRIEQWVDCSSFVFESTERSDEGRYTVKVTSPTGECSTSIFVRIVDVPDPPEAVRVTS
VGEDWAILVWDPPKYDGGQPVTGYLLERKKKGSQRWMKLNFEVFTDTTYESTNMIEGIFY
EMRVFAVNAIRASQPSMNTKPFMPVAPTSEPQHLMVEDVTDTTATLKWRPPERIGGGGID
GYLVEYCLEGSNEWIPANTEPTERCVFTVKNLPTGAKIDFRVVELNIAGRSQPATLXPVT
IREIVEQPKIRLHRHHRQTYIRKVGEQLNLRHPLPGKATAQEEWFTVYEHNRHTSCTVSD
LIVGNEYYFRVYSENICGLSDLPGVSKNTARILKKGLTLKPFEYQEHDFRTAPKFLTPLI
DRVVIAGYSAALNCAVRGHPKPKVVWMKNKMEIGEDPKFLMTNHQGVLTLNIRRPSPFDA
GTYSCRAVNELGEALAECRLDVRGEDAGSPTYCLADPYSCPLQTEQGAPGKAMLGSREDS
ALG
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggtcattcacagactcgcacgaagcagtgaaaaatctgagttaccccacgtgcacgtt
cccagccaagcgaagcagttggaagtcctgcaggatgtcgcagatctgacagtgaaggct
gcagaacgggctgagttcacctgcgaggtatctgatgagaaggtattctcggccacagag
ggcaggacccgcattgagcagtgggtcgactgcagcagcttcgtgttcgagagtactgag
cgatcagatgaaggccgctacactgtcaaggtcaccagccccactggcgaatgctcgacc
tccatcttcgtgagaattgtggatgtcccagaccccccagaggctgtgcgtgtcacctca
gttggagaggattgggccatccttgtctgggacccacccaagtatgacggaggtcagcca
gtcaccgggtacctcctggagcggaaaaagaagggctctcagcgctggatgaagctgaac
tttgaggtctttacggacacaacctacgagtccaccaatatgatcgagggcattttctat
gagatgcgagtctttgctgtcaacgccattagagcctcccagcccagcatgaacaccaaa
ccttttatgcccgttgcacccacgagtgaaccccagcacctgatggtggaggatgtgaca
gacactactgctacactcaagtggaggcctccagaaaggattgggggaggtggcatcgat
gggtacctggtggagtactgcctggagggatctaatgaatggatccctgctaacacggag
cccacagagcgatgtgtcttcactgtcaagaatctcccaacaggagcaaaaatagacttc
agggttgttgagctcaacattgcaggacgaagccagccggctaccctgnacccagtcacc
atccgggagattgtagagcaacccaagatccgactccaccgccatcatcgccagacttat
atccgcaaagtgggggagcagctcaaccttcgtcatccccttccagggaaagccacggcc
caggaggagtggttcaccgtttacgagcacaatcgccatacctcctgcactgtgtctgac
ctcatcgtgggcaacgaatactatttccgtgtatacagtgagaacatctgtggactcagt
gacttacctggtgtctccaagaacacggcccgtatcctcaagaaaggactcaccctcaaa
ccgtttgagtaccaggagcatgacttccgaacagctcccaagttcctgacacctctaata
gaccgggttgtcattgctgggtattctgctgctctcaactgcgctgtcagaggccaccct
aagccgaaggtggtctggatgaagaacaagatggagattggtgaagaccccaagttcctg
atgaccaatcaccagggagtcctgacactgaacatccgccgcccttccccctttgacgct
gggacttactcctgtcgggccgtcaatgagctgggggaggcgctggctgagtgccggctg
gacgtccgaggtgaggatgcggggtcccctacatattgcctggctgacccttactcctgt
cctttacaaacagaacagggggccccagggaaagcaatgttaggatccagagaggactca
gccctgggctaa

KEGG   Loxodonta africana (African savanna elephant): 100665230
Entry
100665230         CDS       T04351                                 

Gene name
MYBPC3
Definition
(RefSeq) myosin-binding protein C, cardiac-type
  KO
K12568  myosin-binding protein C, cardiac-type
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100665230 (MYBPC3)
   05414 Dilated cardiomyopathy
    100665230 (MYBPC3)
SSDB
Motif
Pfam: I-set Ig_3 fn3 Ig_2 ig V-set C2-set_2 C1-set
Other DBs
NCBI-GeneID: 100665230
NCBI-ProteinID: XP_023406679
LinkDB
Position
Unknown
AA seq 1146 aa
MPEPGKKTVSAFSKKPRSAEVAAGSSAIFEAETERPGVKVRWQRGGSDISTSDKYSLAAE
GRRHTLTVQDAGPADQGSYAVIAGSSKVKFDLKVIEAAPAPAPAAAPAPAPTEAPGALAP
ATELEGSSPSPKGSSSEAPDGPAPGSPGAPDDPIGLFVTRPQDGEVTAGGNITFSARVAG
ASLLKPPVVKWFKGKWVDLSSKVGQYLQLRDSYDRTSKVYLFELHITDAQITFAGGYRCE
VSTKDKFDSCNFNLTVHEAIGPGDLDLRSAFRRTSLAGGGRRISDSHEDAGTLDFSSLLK
KRTWATASYAVGGGRPLVWARPGEQGVVASGWVAEGCIYSAFQKKLQPAYQVSKGHKIRL
VVELADPDAEVKWLKNGQEIQMSGSKYIFESVGNKRTLTISQCSLADDAAYQCVVGGEKC
TSELFVKGGPGTLGLGWGGVGVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI
DFVPRQEPPKIHLDCPGRKPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKVPAG
PALDAPEDEGDSEEWVFDKKLLCDTEGRVHVETTKDRSIFIVEGAEKEDEGVYTVTVKNP
VGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSF
RWMRLNFDLLRELTLEAQRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHL
AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCQEGCSEWVAALQGLIERTSLLVKDLPT
GARMLFRVRAHNVAGPGAPVTTKEPVTVQEILQRPWLHLPRHLRQTIQRKVGEPVNLLIP
FQGKPRPQITWTREGQLLAGEEVSIRNSPTDTILFIRAARRTHSGTYQVTVRIENMEDKA
TLVLQIVDKPSPPQDIRVIEAWGFNVALEWKPPQDDGNTELWGYTVQKADKKTMEWFTVL
EHYRHTHCVVPELVIGNGYYFRVFSHNAVGPSDTAATTKEPVFIPKPGITYELPRYKALE
FSEAPRFTRPLVNRSVIAGYNAVLCCAVRGSPKPKISWFKNGLDLGKNARFRMFCKEGVL
TLEIRKPCPFDRGIYACRATNLEGEAQCECLLEVRGEEALGQGLGRGSRAPTGTLLCCPG
PCNCSG
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgccagagcccgggaaaaaaacagtttcagccttcagcaagaagccacggtcagcggag
gtggccgcgggcagctctgccatattcgaggcagagacagagcggccaggagtgaaggtg
cgctggcagcggggaggcagtgacatcagcaccagcgacaagtacagcctggcagccgag
ggcaggcgacacacgctgacagtgcaggacgcaggccccgccgaccaggggtcctatgca
gtcatcgctggctcctccaaggtcaagtttgacctcaaagtcatagaggcagcccctgcc
ccagcccctgctgcagctcctgccccagcccctactgaagcccctggagccttggcccca
gccactgagttggaaggaagctccccaagtcccaaaggatcaagctcagaagcccccgat
ggccctgccccggggtcccctggagctcctgatgaccccattggtctctttgtgacgcgg
ccacaggatggcgaggtgaccgcgggtggcaacatcaccttctctgcccgtgttgctggg
gccagcctcctgaaaccgcctgtggtcaagtggttcaagggcaagtgggtggatttgagc
agtaaggtgggccaatacctgcagttgcgtgacagctatgaccggaccagcaaggtctac
ctgtttgagctgcacatcaccgatgcccagatcacctttgcaggcggctaccgctgtgag
gtgtccaccaaggacaagtttgacagctgcaacttcaacctcaccgtccatgaggccatt
ggccctggagacctggacctccgatcggctttccgccgcacgagcctggctggaggtggt
cggaggatcagtgacagccacgaggatgccgggactctggacttcagctccctgctgaag
aagaggacctgggccactgcctcatatgctgtgggtggtgggaggcctctggtctgggcc
aggccaggggagcagggtgtggtggccagtggctgggtggctgaggggtgcatatactca
gcctttcagaagaagctgcagccagcctaccaggtgagcaagggccacaagatccggctg
gtcgtggagttggcagaccctgatgctgaggtcaagtggcttaagaatggacaggagatc
cagatgagtggcagcaagtacatcttcgagtccgttggcaacaagcgcacactgaccatc
agccagtgctcactggctgacgacgcggcctaccagtgcgtggtgggtggggagaaatgc
acttcggagctgtttgtcaaaggtgggcctgggaccctgggattgggctggggtggggtg
ggggtccacaagctgaccattgacgacgtcacgcctgcagacgaggctgactacagcttt
gtgcccgagggcttcgcctgcaacctgtcagccaagcttcatttcatggaggtcaagatc
gacttcgtgcccaggcaggaaccccctaagatccacctggactgcccaggccgcaaaccg
gataccatcgtcgttgtggctgggaacaagcttcgtctggatgtgcctatctctggggac
cctgctcccacagtgatctggcagaaggccatcacacaggggaataaggtcccagctggg
ccagcacttgatgccccagaggatgaaggtgacagtgaagaatgggtgtttgataagaag
ttgctgtgtgacactgagggcagggtccatgtggagaccaccaaggatcgcagcatcttc
atcgttgagggggcagagaaggaagacgagggcgtctacactgtcacagtgaagaaccct
gtgggcgaggaccaggtcaacctcaccgtcaaggtcatcgatgtgcccgatgctcctgcg
gcccccaagatcagcaacgtgggcgaggactcctgtacggtgcagtgggagccacctgcc
tacgacggcgggcagccgatcctgggctacatcctggagcgcaagaaaaagaagagcttc
cggtggatgcggctgaactttgacttgctgcgggagctgaccctcgaggcccagcgcatg
atcgagggtgtagtgtatgagatgcgagtctacgcagtcaacgccatcggcatgtccagg
cccagccccgcctcccagcccttcatgcccattggaccccccagcgagcccacccacctg
gctgtggaggatgtctctgataccacagtctccctcaagtggcggcccccagagcgtgtg
ggagcaggcggcctggacggctacagtgtggagtactgccaggagggctgctcagagtgg
gtggctgccctgcaggggctgatagagcgcacgtcactgctggtgaaggacctgcctacg
ggggcccggatgctcttccgcgtgcgggctcacaatgtggccgggcccggggcccctgtc
accaccaaggagcctgtgacagtgcaagagatactgcagcggccatggctccacctgccc
aggcatctgcgccagaccatccagaggaaggtcggggagcccgtgaacctccttattcct
ttccagggcaagcccaggcctcagatcacctggaccagagaggggcagctgctggcaggc
gaggaggtgagcatccgaaacagccccacggacaccatcctgttcatccgggccgcccgc
cgcacccactcgggcacctaccaggtgacggtgcgcatcgagaacatggaggacaaggcc
acgctggtcctgcagatcgtcgacaagccaagtcctccccaggacattcgggtcattgag
gcttggggtttcaatgtggctctggagtggaagccaccccaagatgatggcaacaccgag
ctctggggttacacagtgcagaaagccgacaagaagaccatggagtggttcaccgttttg
gagcactaccgccacactcactgtgtggtgccagagctcgtcatcggcaatggctactac
ttccgggtctttagccacaacgcggtgggtccaagtgacacagccgccaccaccaaggag
cccgtcttcatccccaaaccaggcatcacctacgagctacccagatacaaggccctggaa
ttctctgaggccccacgcttcacccgtcccctggtgaaccgctcagtcatcgcaggctac
aatgccgtcctctgctgcgctgtgcggggtagccccaagcccaaaatttcctggttcaag
aatggcctggacctgggtaaaaacgcccgcttccgcatgttctgcaaggagggtgtgttg
accctggagattcggaagccgtgcccctttgataggggcatctatgcctgtagggccacc
aacttagaaggcgaagcacagtgtgagtgcctcctggaggtgcgaggtgaggaagccctg
ggccagggcctggggaggggaagcagggcacccactgggactctgctctgctgtcctggt
ccatgcaactgctctggctga

DBGET integrated database retrieval system