KEGG   Loxodonta africana (African savanna elephant): 100656672
Entry
100656672         CDS       T04351                                 

Gene name
GNAQ
Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha isoform X1
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04020  Calcium signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04062  Chemokine signaling pathway
lav04071  Sphingolipid signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04611  Platelet activation
lav04713  Circadian entrainment
lav04720  Long-term potentiation
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04750  Inflammatory mediator regulation of TRP channels
lav04911  Insulin secretion
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04918  Thyroid hormone synthesis
lav04921  Oxytocin signaling pathway
lav04922  Glucagon signaling pathway
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
lav04970  Salivary secretion
lav04971  Gastric acid secretion
lav04972  Pancreatic secretion
lav05010  Alzheimer disease
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05022  Pathways of neurodegeneration - multiple diseases
lav05135  Yersinia infection
lav05142  Chagas disease
lav05143  African trypanosomiasis
lav05146  Amoebiasis
lav05163  Human cytomegalovirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100656672 (GNAQ)
   04371 Apelin signaling pathway
    100656672 (GNAQ)
   04020 Calcium signaling pathway
    100656672 (GNAQ)
   04071 Sphingolipid signaling pathway
    100656672 (GNAQ)
   04022 cGMP-PKG signaling pathway
    100656672 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100656672 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100656672 (GNAQ)
   04062 Chemokine signaling pathway
    100656672 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    100656672 (GNAQ)
   04922 Glucagon signaling pathway
    100656672 (GNAQ)
   04929 GnRH secretion
    100656672 (GNAQ)
   04912 GnRH signaling pathway
    100656672 (GNAQ)
   04915 Estrogen signaling pathway
    100656672 (GNAQ)
   04921 Oxytocin signaling pathway
    100656672 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    100656672 (GNAQ)
   04918 Thyroid hormone synthesis
    100656672 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    100656672 (GNAQ)
   04916 Melanogenesis
    100656672 (GNAQ)
   04924 Renin secretion
    100656672 (GNAQ)
   04925 Aldosterone synthesis and secretion
    100656672 (GNAQ)
   04927 Cortisol synthesis and secretion
    100656672 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100656672 (GNAQ)
   04270 Vascular smooth muscle contraction
    100656672 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    100656672 (GNAQ)
   04971 Gastric acid secretion
    100656672 (GNAQ)
   04972 Pancreatic secretion
    100656672 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100656672 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    100656672 (GNAQ)
   04725 Cholinergic synapse
    100656672 (GNAQ)
   04728 Dopaminergic synapse
    100656672 (GNAQ)
   04726 Serotonergic synapse
    100656672 (GNAQ)
   04720 Long-term potentiation
    100656672 (GNAQ)
   04730 Long-term depression
    100656672 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    100656672 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100656672 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100656672 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100656672 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100656672 (GNAQ)
   05016 Huntington disease
    100656672 (GNAQ)
   05017 Spinocerebellar ataxia
    100656672 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    100656672 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100656672 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100656672 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100656672 (GNAQ)
   05163 Human cytomegalovirus infection
    100656672 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100656672 (GNAQ)
   05142 Chagas disease
    100656672 (GNAQ)
   05143 African trypanosomiasis
    100656672 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100656672 (GNAQ)
   04031 GTP-binding proteins [BR:lav04031]
    100656672 (GNAQ)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100656672 (GNAQ)
GTP-binding proteins [BR:lav04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    100656672 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 100656672
NCBI-ProteinID: XP_023400502
LinkDB
Position
Unknown
AA seq 372 aa
MGIDVTYICCVYEPREKEYEKHMFLLYLLWDPKMSPASLFLFSVVSPAPTSGLTRYILGT
GESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNK
AHAQLVREVDVEKVAAFESPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRV
ADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIM
FLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSH
LVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDT
ILQLNLKEYNLV
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgggaattgatgtcacctacatttgttgtgtttatgaacccagggaaaaagagtatgag
aaacatatgtttttactttatcttctgtgggaccctaaaatgagccctgcatctctattt
ttatttagtgttgtatccccagcacccacctcaggacttaccaggtatatacttgggaca
ggagagagtggcaagagcacatttatcaagcaaatgagaatcatccacgggtctggatac
tctgatgaagacaaaaggggcttcaccaagctggtgtaccagaacatcttcacagccatg
caggccatgatcagagccatggacacgctcaagatcccatacaagtatgaacacaataag
gctcatgcacaattagttcgagaagttgatgtggagaaagtggctgcttttgagagcccg
tacgtagatgccataaagagtttatggaatgatcctggaatccaggagtgctacgataga
cgacgagaatatcagttatctgactctaccaaatactatcttaatgacttggaccgcgta
gccgaccctgcctatctgcctactcaacaagatgtgcttagagttcgagtccccaccaca
gggatcatcgaatacccttttgacttacaaagtgtcattttcagaatggtggatgtagga
ggccaaaggtcagagagaagaaaatggatacactgctttgaaaatgtcacctctatcatg
tttctagtagcacttagtgaatatgatcaagtcctggtggagtcagacaatgagaaccga
atggaggaaagcaaagcactctttaggacaattatcacatacccctggttccagaactcc
tcggttattctgttcttaaacaagaaagatcttctagaggagaaaattatgtattcccac
ctagttgactacttcccagaatatgatggaccccagagagatgcccaggcagctcgagaa
ttcatcctgaagatgttcgtggacctgaacccagacagtgacaaaataatctactcccac
ttcacatgcgccacagacaccgagaatatccgctttgtctttgctgccgtcaaggacacc
atcctccagctgaatctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system