KEGG   Loxodonta africana (African savanna elephant): 100656755
Entry
100656755         CDS       T04351                                 

Gene name
ERBB4
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-4
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04020  Calcium signaling pathway
lav04151  PI3K-Akt signaling pathway
lav05014  Amyotrophic lateral sclerosis
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100656755 (ERBB4)
   04012 ErbB signaling pathway
    100656755 (ERBB4)
   04020 Calcium signaling pathway
    100656755 (ERBB4)
   04151 PI3K-Akt signaling pathway
    100656755 (ERBB4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100656755 (ERBB4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100656755 (ERBB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100656755 (ERBB4)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100656755 (ERBB4)
Protein kinases [BR:lav01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100656755 (ERBB4)
SSDB
Motif
Pfam: Recep_L_domain GF_recep_IV Furin-like PK_Tyr_Ser-Thr DUF3951
Other DBs
NCBI-GeneID: 100656755
NCBI-ProteinID: XP_023397616
LinkDB
Position
Unknown
AA seq 770 aa
MKLATGLWVWVSLLVAAGTVQPSASQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNRLCSNDGCWRPEPDQCLSCRRFSRRRTCIESCNLYD
GEFREFENGSICVECDPQCERMEDGILTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADQDRECHPCHPNCTQGCIGSSIEDCIGLMDRTPLIAAGVIGGLFILVIMGLT
FAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFG
TVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDVSTDTQTFISIIK
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgaagctggcgacaggactgtgggtctgggtgagccttcttgtggcggcggggaccgtc
cagcccagcgcttctcagtcagtgtgtgcaggaacagagaataaactgagctctctgtct
gacctggaacagcagtaccgagccttgcgcaaatactatgagaactgtgaagtagtcatg
ggcaacctggagataaccagcattgagcacaaccgggacctctccttcctgcggtctatt
cgagaagtcacaggctacgtgttagtggctcttaatcagtttcgttacctgcctctggaa
aacttacgtattattcgtgggacaaaactttatgaagatcgatatgccttggcgatattt
ttaaactacagaaaagatgggaactttggacttcaagaacttggactgaagaacttgaca
gaaatcctgaatggcggagtctatgtagaccagaacaaattcctttgttatgcagacaca
attcactggcaagatattgttcggaatccatggccttccaacttgactctggtatcaaca
aatggtagctctggatgtggacgttgccataagtcctgtactggccgatgctggggaccc
acagaaaatcattgccagactttgaccaggacagtgtgcgcagaacaatgtgatggcagg
tgctacggaccctacgtcagtgactgctgccatcgagaatgtgctggaggctgctcggga
cctaaggacactgactgctttgcctgcatgaatttcaatgacagtggagcatgtgttact
cagtgtccccaaacttttgtctacaatccaaccacctttcaattggagcacaatttcaat
gctaagtacacatatggagcattctgtgtcaagaaatgcccacataactttgtggtagat
tccagttcttgtgtacgtgcctgtcctagttccaagatggaagtagaagaaaatggcatc
aaaatgtgtaaaccttgcactgatatttgcccaaaagcttgcgacggcattggtacagga
tcgttgatgtcagctcagaccgtggattccagtaacattgacaaattcataaactgcacc
aagatcaatgggaatttgatcttccttgtcactgggattcatggggacccttacaatgca
attgaagccatagacccagagaaactgaatgtctttcggacagtcagagagataacagga
ttcttgaacatacaatcatggcccccaaacatgaccgacttcagtgttttctctaacctg
gtcactattggtggacgagtactgtatagtggcctctccttgcttatcctcaagcaacag
ggcatcacttctctgcaatttcagtctctgaaggaaatcagtgcaggaaacatctacatt
accgacaacagcaatttatgttattatcataccattaactggacaacgctcttcagcacc
atcaaccaaagaattgtgatccgggataacaggaaggctgaaaattgtactgcagaggga
atggtatgcaaccgtctctgttcaaatgatggctgttggagacctgagccagaccagtgc
ctgtcatgccgacgcttcagtaggagaaggacctgcatagagtcttgtaacctctatgat
ggtgaatttcgggagtttgagaatggctccatctgtgtggagtgcgacccccagtgtgag
aggatggaagatggcattctcacatgccatggaccgggacctgacaactgtacaaagtgc
tcccattttaaggatggcccaaactgtgtggaaaagtgtccagatggcttacaaggggca
aacagtttcatttttaagtacgctgatcaggatcgggaatgccatccgtgtcatccgaac
tgtacccaagggtgcataggctcaagtattgaagactgcatcggcctgatggatagaact
cccctgattgcagctggagtcattggtgggctcttcatcctggtcatcatgggtctgaca
tttgcagtttatgtcagaaggaaaagcatcaaaaagaaaagagccttgagaagattcctg
gaaacagagttggtagaacccttaactcccagtggcacagcacccaatcaagctcagctt
cgtattttgaaagaaactgagctcaagagagtaaaagtacttggatctggtgcttttgga
actgtttataaaggcatttgggtacctgaaggagaaacagtgaagattcctgtggctatt
aagatcctcaatgagacaacaggccctaaagccaatgtggagtttatggatgtaagtaca
gacacccagacatttatctccattattaaatag

DBGET integrated database retrieval system