KEGG   Loxodonta africana (African savanna elephant): 100656780
Entry
100656780         CDS       T04351                                 

Gene name
MYL3
Definition
(RefSeq) myosin light chain 3
  KO
K12749  myosin light chain 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04371  Apelin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100656780 (MYL3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100656780 (MYL3)
   04261 Adrenergic signaling in cardiomyocytes
    100656780 (MYL3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100656780 (MYL3)
   05414 Dilated cardiomyopathy
    100656780 (MYL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100656780 (MYL3)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100656780 (MYL3)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 CAP_N Cas9_REC Homeodomain
Other DBs
NCBI-GeneID: 100656780
NCBI-ProteinID: XP_023403889
LinkDB
Position
Unknown
AA seq 205 aa
MTGQDKGLVAEAHLPSSLYLLPRTLSVLVTSMAPKKPEPKKDEAKAASKAAPAPAPAPAP
APPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFQLYDRTPKCEMKITYGQCGDVLRAL
GQNPTQAEVLRVLGKPKQDELNSKMMDFNTFLPMLQHISKNKDTATYEDFVEGLRVFDKE
GNGTVMGAELRHVLATLGERLSEDE
NT seq 615 nt   +upstreamnt  +downstreamnt
atgaccgggcaggataaaggcctggttgcggaggctcacctaccctcatctctgtacctg
ctccccaggaccctctctgtgctggtaacctccatggcccccaaaaagccagagcccaag
aaggacgaggccaaggcagcctccaaggcggctccagctccagctccagctccagctcca
gcgcccccgcctgagcctgagcgccccaaggaggtggagtttgatgcctccaagattaag
atcgagttcacaccagagcagattgaagagttcaaggaagcgttccagctgtatgatcgc
acacccaagtgtgagatgaagatcacatacgggcagtgtggggatgtcctgcgggcgctg
ggccagaaccccacgcaggctgaggtgctccgtgtcctggggaaaccaaagcaggacgaa
ctaaactccaagatgatggacttcaacacgttcctgcccatgctgcagcacatttccaag
aacaaggacacggccacttacgaggacttcgtggaggggctgcgggtctttgataaggag
ggcaacggcactgtcatgggtgccgagctccgtcatgtgctggccacgctgggtgagagg
ctgagtgaagatgag

DBGET integrated database retrieval system