KEGG   Loxodonta africana (African savanna elephant): 100656780
Entry
100656780         CDS       T04351                                 

Gene name
MYL3
Definition
(RefSeq) myosin light chain 3
  KO
K12749  myosin light chain 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04371  Apelin signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100656780 (MYL3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100656780 (MYL3)
   04261 Adrenergic signaling in cardiomyocytes
    100656780 (MYL3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100656780 (MYL3)
   05414 Dilated cardiomyopathy
    100656780 (MYL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100656780 (MYL3)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100656780 (MYL3)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 CAP_N Cas9_REC Homeodomain
Other DBs
NCBI-GeneID: 100656780
NCBI-ProteinID: XP_023403889
LinkDB
Position
Unknown
AA seq 205 aa
MTGQDKGLVAEAHLPSSLYLLPRTLSVLVTSMAPKKPEPKKDEAKAASKAAPAPAPAPAP
APPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFQLYDRTPKCEMKITYGQCGDVLRAL
GQNPTQAEVLRVLGKPKQDELNSKMMDFNTFLPMLQHISKNKDTATYEDFVEGLRVFDKE
GNGTVMGAELRHVLATLGERLSEDE
NT seq 615 nt   +upstreamnt  +downstreamnt
atgaccgggcaggataaaggcctggttgcggaggctcacctaccctcatctctgtacctg
ctccccaggaccctctctgtgctggtaacctccatggcccccaaaaagccagagcccaag
aaggacgaggccaaggcagcctccaaggcggctccagctccagctccagctccagctcca
gcgcccccgcctgagcctgagcgccccaaggaggtggagtttgatgcctccaagattaag
atcgagttcacaccagagcagattgaagagttcaaggaagcgttccagctgtatgatcgc
acacccaagtgtgagatgaagatcacatacgggcagtgtggggatgtcctgcgggcgctg
ggccagaaccccacgcaggctgaggtgctccgtgtcctggggaaaccaaagcaggacgaa
ctaaactccaagatgatggacttcaacacgttcctgcccatgctgcagcacatttccaag
aacaaggacacggccacttacgaggacttcgtggaggggctgcgggtctttgataaggag
ggcaacggcactgtcatgggtgccgagctccgtcatgtgctggccacgctgggtgagagg
ctgagtgaagatgag

KEGG   Loxodonta africana (African savanna elephant): 100665527
Entry
100665527         CDS       T04351                                 

Gene name
MYL4
Definition
(RefSeq) myosin light chain 4
  KO
K12750  myosin light chain 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100665527 (MYL4)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100665527 (MYL4)
   04261 Adrenergic signaling in cardiomyocytes
    100665527 (MYL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100665527 (MYL4)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100665527 (MYL4)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_9 EF-hand_6 EF-hand_7 CAP_N CCDC53
Other DBs
NCBI-GeneID: 100665527
NCBI-ProteinID: XP_003414361
UniProt: G3TUQ7
LinkDB
Position
Unknown
AA seq 256 aa
MFLPFIVSSSCSCSHPAPLRGLLPRIKGREEAQSPVLSPRHRISRSFLRSHLQQRVQQDN
MPPKKPEPKKEAAKAPASAPAPAPAPASAPEPPKEPAFDPKSVKIDFSADQIEEFKEAFS
LFDRTPAGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNTKMLDFETFLPILQ
HISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKLTEAEVEQLLAGQEDA
NGCINYEAFVKHIMSG
NT seq 771 nt   +upstreamnt  +downstreamnt
atgtttcttccttttatagtcagcagcagttgctcttgctctcacccagcccctctgcgg
gggctccttcccaggataaaagggagggaggaggcccagtctcctgtcttgtctcccagg
caccgcatctctcgctccttccttaggtcccacctccagcaaagagtccagcaagacaac
atgcctcccaagaagccagagcctaagaaggaggcagctaaggccccagcctcagcccca
gcccctgccccagccccagcctcagcccctgagccaccaaaggaacctgcttttgacccc
aagagtgtaaagatagacttctctgctgaccagattgaagagttcaaagaggccttctca
ttgtttgaccggaccccggctggagagatgaagatcacctatgggcagtgcggcgacgta
ctacgggccctgggccagaaccccaccaacgcggaggtgttgcgtgtcctgggcaagccc
aagcctgaagagatgaacaccaagatgctggacttcgagacgttcctgcccatcctgcaa
cacatttcccgcaacaaggagcagggcacctatgaggacttcgtggaggggctgcgcgtt
tttgacaaggagagcaatggcacggtcatgggcgctgagcttcggcatgtcctggctacc
ctgggagagaagctgactgaggccgaagtggagcagctgttagctgggcaagaggatgcc
aatggctgcatcaattacgaagcctttgtcaagcatatcatgtctgggtga

KEGG   Loxodonta africana (African savanna elephant): 100670087
Entry
100670087         CDS       T04351                                 

Definition
(RefSeq) myosin-6 isoform X1
  KO
K17751  myosin heavy chain 6/7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04919  Thyroid hormone signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100670087
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100670087
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100670087
   04261 Adrenergic signaling in cardiomyocytes
    100670087
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100670087
   05414 Dilated cardiomyopathy
    100670087
   05416 Viral myocarditis
    100670087
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100670087
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100670087
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Crescentin IQ
Other DBs
NCBI-GeneID: 100670087
NCBI-ProteinID: XP_023395848
LinkDB
Position
Unknown
AA seq 1576 aa
MGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVYYSIGALAKAVYEKMFNWMVTRINSTL
ETRQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIE
WEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNFQKPR
NIKGRQEAHFSLIHYAGTVDYNILGWLEKNKDPLNETVVGLYQKSSLRLMATLFSSYASA
DAADSSKGKGGKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGVMDN
PLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGTEKLL
GSLDIDHNQYKFGHTKVFFKAGLLGLLEDMRDERLSRIITRIQAQARGQLMRIEFKKIVE
RRDALLVIQWNIRAFMAVKNWPWMKLYFKIKPLLKSAETEKEMANMKEEFGRIKEALEKS
EARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMTERL
EDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLD
EIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRM
DLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQALALQLQK
KLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKK
REAEFQKMRRDLEEATLQHEATAAALRKKHADSVASSVEQIDNLQRVKQKLEKEKSEFKL
ELDDVTSNMEQIIKAKANLEKLSRTLEDQANEYRMKLEEAQRSLNDFTTQRAKLQTENGE
LSRQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALHSARHDCDLLREQ
YEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEA
VNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSE
LESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHEL
EKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLTEKDEEMEQA
KRNHLRVVDSMQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSQANRTASEAQKHLKIT
QAHLKDTQIQLDDAVHANDDLKENIAIVERRNTLLQAELEELRAMVEQTERSRKLAEQEL
IETSERVQLLHSQNTSLINQKKKMESDLTQLQSEVEEAVQECRNAEEKAKKAITDAAMMA
EELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENEL
EAEQKHNVESVKGMRKSERRIKELTYQTEEDKKNLLRLQDLVDKLQLKVKAYKRQAEEAE
EQANTNLSKFRKAQHELDEAEERADIAESQVNKLRAKSRDISAKVGSSPSPPDMSAPQNR
HSSPCIWTALRVSQHL
NT seq 4731 nt   +upstreamnt  +downstreamnt
atggggctgaactcagctgacctgctcaaagggctttgccaccctcgggtgaaagtgggc
aacgagtacgtcactaaggggcagaacgtgcagcaggtgtactactcaatcggggcactg
gccaaggcagtgtacgagaagatgttcaactggatggtgacaaggatcaactctaccctg
gagaccaggcagccgcgccagtacttcataggagtcctcgacattgctggctttgagatc
ttcgatttcaacagctttgaacagctctgcatcaacttcaccaacgagaagctgcagcag
ttcttcaaccaccacatgttcgtgctggagcaggaggagtacaagaaggagggcatcgag
tgggagttcatcgacttcggcatggacctgcaggcctgcatcgacctcatcgagaagccc
atgggcatcatgtccatcctggaggaggagtgcatgtttcccaaggccaccgacatgacc
tttaaggccaagctgtatgacaaccacctgggcaagtccaacaacttccagaagccacgc
aatatcaaggggaggcaggaagcccacttctccctgatccactatgctggcactgtggac
tacaacatcctgggctggctggagaagaataaagacccactcaatgagacggtggtgggc
ttgtaccagaaatcctctctgaggctcatggccacactcttttcctcttatgctagtgct
gatgccgcggatagcagtaaaggcaaaggaggcaagaaaaagggttcatcctttcagacg
gtgtcagccctccaccgggagaacctgaacaagctgatgaccaacctgaggaccacccac
cctcactttgtgcgctgcatcatccccaatgaacggaaggctcctggggtgatggacaac
cccctggttatgcaccagctgcgctgcaatggcgtgctagagggcatccgcatctgcagg
aagggcttccccaaccgcatcctctatggggacttccggcagagataccgcatcctgaac
ccagcggccatccccgaaggacagtttattgacagcaggaaagggacagagaagctgctg
ggctccctggacatcgatcacaaccagtataagtttggccataccaaggtgttcttcaag
gcggggctgctggggttgctggaggacatgcgggacgaaaggctgagccgcatcatcacc
cgcatccaggcccaagcccggggacagctcatgcgcattgagttcaaaaagatcgtggag
cgcagggacgccctgctggtaatccagtggaacatccgggccttcatggcagttaagaac
tggccctggatgaagctctacttcaagatcaagccactgctgaagagtgcagagacagag
aaggagatggccaacatgaaagaggagtttgggcgcatcaaagaggcgctggagaagtct
gaggctcgccgcaaggagctggaggagaagatggtatccctgctgcaggagaagaatgac
ctgcagctccaagtgcaggcggaacaagacaaccttaacgatgcggaggagcgctgcgac
cagctgatcaaaaacaagatccagctggaggccaaggtgaaggagatgaccgagaggctg
gaggacgaggaggagatgaacgctgagctcactgccaagaagcgcaagctggaggatgag
tgctccgagctcaagaaagatattgacgacctggagctgacgctggccaaggtggagaag
gagaagcatgcaacagagaacaaggtgaagaacctgacagaggagatggctgggctggat
gagatcatcgccaagctgaccaaggagaagaaagctctgcaagaggctcaccagcaggcc
ctggatgaccttcaggccgaggaggacaaggtcaacaccctgaccaagtctaaggtcaag
ctggagcagcaggtggatgaccttgagggatccctggagcaggagaagaaggtgcgcatg
gacctggaacgagcaaagcggaagttggagggtgacctgaagctgacccaggagagcatc
atggacctggagaatgataaactacagctggaagaaaagctcaagaaaaaggaatttgac
attaaccagcagaacagtaagattgaggatgagcaggcactggcccttcagctgcagaag
aaactgaaggaaaaccaggcacgcattgaggagctggaggaggagctggaggccgagagg
acggccagggccaaggtggagaagctgcgctccgacctgtcccgggagctggaggagatc
agcgagcggctggaagaggccggcggggccacgtccgtgcagatcgagatgaacaagaag
cgcgaggccgagttccagaagatgcggcgagacctggaggaggccacgctgcagcatgag
gccacggctgctgccctgcgcaagaagcacgcagacagcgtggcgagctcggtggaacag
atcgacaacctgcagcgggtgaagcagaagctggagaaggagaagagtgagttcaagctg
gagctggacgatgtcacatccaacatggagcagatcatcaaggccaaggcaaatttggag
aagttgtcccggacgctggaggaccaggccaatgagtaccgcatgaagctggaagaggcc
caacgctccctcaatgatttcaccacccagagagccaagctgcagacagagaatggagag
ctgtccaggcagctagaggaaaaggaggctctgatctcccagctgacccgaggaaagctc
tcctacacccagcaaatggaggacttaaaaaggcagctggaggaagaaggcaaggcgaag
aacgccctggcacatgctctacactcagcccggcacgactgtgacctgctgcgggagcag
tatgaggaggagatggaagccaaggccgagctgcagcgcgtgctgtccaaggccaactca
gaggtggcccagtggaggacgaagtatgagacagatgccatccagcggaccgaggagctc
gaggaggccaagaagaagctggcccagaggctgcaagacgccgaggaggctgtagaggct
gtcaatgccaagtgctcgtcactggagaagaccaagcaccggctgcagaatgagatcgag
gatctcatggtggacgtggagcgctccaatgccgccgctgcagccctggacaagaagcag
aggaacttcgacaagatcctggccgagtggaagcagaagtacgaggagtcacagtcagag
ctggagtcctcacagaaggaggcgcgctccctcagcacggagctcttcaagctcaagaac
gcctacgaggagtccctggagcacctggagaccttcaagcgggagaacaagaaccttcag
gaggagatctcagacctgactgagcagctgggagaaggaggaaagaatgtgcatgagctg
gagaagatccgcaagcagctggaggtggagaagctggagctgcagtcggccctggaggag
gctgaggcctccctggagcatgaggagggcaagatcctccgggcccagctggagttcaac
cagatcaaggcagagattgagcggaagctgaccgagaaggacgaggagatggaacaggcc
aaacgcaaccacttacgtgtggtggactcgatgcagacctccctggacgcggagacgcgc
agccgcaacgaggccctgcgggtgaagaagaagatggagggtgaccttaatgagatggag
atccagctcagccaggccaacaggacagcttcggaggctcagaagcacctgaagatcact
caagcccatctgaaggacacccagatccagctggatgacgcagtccatgccaacgatgac
ctgaaggagaacattgctattgtggaacggcgcaatactctgctgcaggctgagctggag
gagctgcgggccatggtggagcagacagaacggtctcggaagctggctgagcaggagttg
attgagaccagtgagcgagtgcagctgctgcactcccagaacaccagcctcatcaaccag
aagaagaagatggagtcagatctgacccagctccagtcagaagtggaggaagcagtacag
gagtgcaggaatgctgaggagaaggccaagaaggccatcacagatgccgctatgatggcg
gaggagctgaagaaggagcaggacacgagtgcccacctggagcgcatgaagaagaacatg
gagcaaaccatcaaggacctgcagcaccgactggatgaggccgagcagatcgctctcaag
ggcggcaagaagcagctgcagaaactggaggcccgggttcgagagctggagaacgagctg
gaggctgagcagaaacacaatgttgagtcagtcaagggcatgagaaagagtgagcgtcgc
atcaaggagctcacctaccagacggaggaggacaagaagaacctgcttcggctacaagat
ctggtggacaagctgcagctaaaggtcaaggcctacaagcgccaggctgaagaggcggag
gaacaggccaacaccaacctgtccaagttccgcaaagcacagcacgagctggatgaggca
gaggagcgggcagacatcgccgagtcccaggtcaacaagctgcgggccaagagccgtgac
atcagcgccaaggtgggctcctcccccagcccccccgacatgagtgctcctcagaatagg
cactcctcaccctgtatttggacagccctgagggtttcacagcacctataa

KEGG   Loxodonta africana (African savanna elephant): 100670377
Entry
100670377         CDS       T04351                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: myosin-7
  KO
K17751  myosin heavy chain 6/7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04260  Cardiac muscle contraction
lav04261  Adrenergic signaling in cardiomyocytes
lav04919  Thyroid hormone signaling pathway
lav05410  Hypertrophic cardiomyopathy
lav05414  Dilated cardiomyopathy
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100670377
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100670377
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100670377
   04261 Adrenergic signaling in cardiomyocytes
    100670377
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100670377
   05414 Dilated cardiomyopathy
    100670377
   05416 Viral myocarditis
    100670377
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100670377
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100670377
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N IQ Crescentin Filament
Other DBs
NCBI-GeneID: 100670377
NCBI-ProteinID: XP_023395852
LinkDB
Position
Unknown
AA seq 1885 aa
MVDAEMAVFGAAAPFLRKSEKERLADQTRPFDLKKDVYVPDDKEEFVKATIVSREGGKIT
AETERGKTVTVREDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGL
FCVTVNPYKWLPVYTAEVVAAYRGKKRSEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXLRESGAGKTVNTKRVIQYFAVIAAIGDRKKEQTTGKGTLEDQIIEANPALEAFGNAK
TVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKK
PELLDMLLITNNPYDYAFISQGETTVASINDAEELMATDNAFDVLGFTAEEKNSMYKLTG
AIMHFGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKG
QNVQQVVYAKGALAKAVYERMFNWMVMRINSTLETKQPRQYFIGVLDIAGFEIFDFNSFE
QLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSIL
EEECMFPKATDMTFKAKLFDNHLGKSSNFQKPRNIKGKPEAHFSLIHYAGTVDYNILGWL
QKNKDPLNETVVALYQKSSLKMLSTLFANYAGADARKXKLGPRGXRSGKGKGKAKKGSSF
QTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKTPGLIDNPLVMHQLRCNGVLEGIRI
CRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVF
FKAGLLGLLEEMRDERLSRIITRIQAQSRGVLARMEFKKLLERRDSLLIIQWNIRAFMGV
KNWPWMKLYFKIKPLLKSAEREKEMATMKEEFGRLKEALEKSEARRKELEEKMVSLLQEK
NDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLE
DECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQ
QTLDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQE
SIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGIQLQKKLKELQARIEELEEELEA
ERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQ
HEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIVKAKAN
LEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRG
KLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKA
NSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNE
IEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKL
KNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKLELQSAL
EEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAE
TRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQAKSLQSLLKDTQIQLDDAVRAN
DDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLI
NQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKK
NMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEVEQKRNAESIKGMRKSE
RRIKELTYQVRAGQVFWGQALFISV
NT seq 5658 nt   +upstreamnt  +downstreamnt
atggtggatgcggagatggctgtatttggggctgccgcccccttcctgcgcaagtcagag
aaggagcggctcgcagaccaaaccaggccttttgacctcaagaaggacgtttatgtgcct
gatgacaaagaggagtttgtcaaagccacgattgtgtctcgtgagggtggcaaaatcact
gccgagaccgagcgtggcaagacagtgacagtgagggaggatcaggtgatgcagcagaac
ccgcccaagtttgacaagatcgaggacatggccatgttgaccttcctccatgagcccgct
gtgctctacaacctcaaggaacgctatgcctcctggatgatctacacctactcaggcctc
ttctgcgtcactgtcaacccctacaagtggctgccagtgtacactgccgaggtagtggct
gcctaccggggaaagaagagaagtgaggcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnttgcgagaatccggggcaggaaagacagtcaacaccaagagagtcatccag
tactttgctgtcatcgctgccattggagaccgcaaaaaggagcagaccacaggcaaggga
accctggaggaccagatcatagaagccaaccccgccctggaggcctttggcaatgccaag
accgtccggaatgacaactcctcccgctttggaaaattcattcgaatccactttggggca
accggaaaattggcatctgcggacatagagacctaccttctggaaaaatccagagttatt
ttccagctgaaagcagagagagattatcatattttctaccaaatcctctctaacaaaaag
cctgagctgctagacatgctgctgatcaccaacaacccctacgattatgcattcatctcc
caaggagagaccactgtggcctcgattaatgacgctgaagagctcatggccactgataat
gcctttgatgtgctgggcttcactgcagaggagaagaactccatgtacaagctgactggt
gccatcatgcactttgggaacatgaagttcaaactgaagcagagagaggagcaggctgaa
ccagacggcaccgaagaggctgacaagtccgcctacctcatgggcctgaactcagctgac
ctgctcaaggggctttgccaccctcgggtgaaagtgggcaatgagtacgtcaccaaggga
cagaatgtccagcaggtagtgtatgccaaaggtgcactggccaaggcagtgtacgagagg
atgttcaactggatggtgatgcggattaatagcaccctggagaccaagcaaccacgccag
tacttcataggagtactcgacattgctggtttcgagatctttgatttcaacagctttgaa
cagctctgcatcaacttcaccaacgagaagctgcagcagttcttcaaccaccacatgttt
gtgctggagcaggaggagtacaagaaggagggcatcgagtgggagttcatcgacttcggc
atggacctgcaggcctgcatcgacctcattgagaagcccatgggcatcatgtccatcctg
gaggaggagtgcatgttccccaaggccaccgacatgaccttcaaggccaaactgtttgac
aaccacctgggcaagtccagcaacttccagaagccacgcaatatcaaggggaagccggaa
gctcacttctccctgatccactatgctggcactgtggactacaacatcctgggatggctg
caaaagaacaaagacccccttaatgagacagtggtggccttgtaccagaagtcctccctc
aagatgctcagcaccctgtttgccaactacgctggggcagatgcacgtaagtagaaactg
gggccaaggggataaaggagtgggaagggcaaaggcaaggccaagaaaggttcgtccttt
cagacagtgtctgctctgcacagggaaaatctgaataagctgatgaccaacttgcgttcc
acccatccccactttgtgcgttgcatcattcccaatgagacaaagactccagggttgata
gacaaccccctggtcatgcaccagctgcgctgcaacggcgtgctagagggcatccgtatc
tgtaggaagggcttccccaaccgcatcctctatggggacttccggcagagatatcgcatc
ctgaacccagcagctatccccgaggggcagtttattgacagcaggaaaggggcagagaag
ctgctgggctccctggacatcgatcacaaccagtacaagtttggtcacaccaaggtgttc
ttcaaggccggactgctggggctgctggaggagatgcgagatgagaggctgagcagaatc
atcacacgcattcaggcccagtcccggggtgtgctcgccagaatggagttcaagaagctg
ctggaacgaagagactccctgctgataatccagtggaatattcgggctttcatgggggtc
aaaaactggccctggatgaagctctacttcaagatcaagccactgctgaagagtgcagag
agggagaaggaaatggccaccatgaaggaggagttcgggcgcctcaaagaggcactggag
aagtctgaggctcgccgcaaggagctggaagagaagatggtgtccctgctgcaggagaag
aacgacctgcaactccaagtgcaggcggaacaagacaacttggctgatgcagaggaacgc
tgcgaccagctgatcaaaaacaagatccaactggaggccaaggtgaaggagatgactgag
aggctggaggatgaggaggagatgaacgccgagctcactgccaagaagcgcaagctggag
gatgaatgctctgagctcaaaagagacattgacgacctggagctgacgctggccaaagtg
gagaaggagaagcatgcaacagagaacaaggtgaagaacctgacagaggagatggctgga
ttggatgaaatcattgccaaactgaccaaggagaagaaagctctgcaagaagcccaccag
cagaccctggatgaccttcaagcagaggaagacaaggtcaataccctgaccaaggccaag
gtcaagctggagcagcaagtggacgatctggagggatccttggagcaggagaagaaggtg
cgcatggacctggaacgagcaaagcggaagctagagggtgacttgaagctgacccaggaa
agcatcatggacctggagaatgacaagcagcagctggacgagcggctgaaaaagaaggat
tttgagctgaatgctctcaatgcaaggattgaggatgagcaggccctgggcatccagctg
cagaagaagctcaaagagcttcaggcacgcattgaggagctggaggaggagctggaggcc
gagaggacggccagggccaaggtggagaagctgcgctccgacctgtcccgggagctggag
gagatcagcgagcggctggaagaggccggcggggccacgtccgtgcagatcgagatgaac
aagaagcgcgaggccgagttccagaagatgcggcgagacctggaggaggccacgctgcag
catgaggccacggctgctgccctgcgcaagaagcacgcagacagcgtggccgagctcggt
gagcagatcgacaacctgcagcgggtgaagcagaagctggagaaggagaagagcgagttt
aagctggagctggacgatgtcacatccaacatggagcagatcgtcaaggccaaggctaac
ctggagaagatgtgccggaccctggaagaccagatgaatgagcaccgtagcaaggctgag
gagacccagcgttctgtcaatgacctcaccagccagcgggccaagctgcaaactgagaat
ggtgagctgtcccggcagctggatgagaaggaagcactgatctcccagctgacccgaggc
aagctcacctatacccagcagctggaggacctcaagaggcagctagaagaggaagttaag
gcgaagaacgccctggcccacgcgctacagtcagcccggcacgactgcgacctgctgcgg
gagcagtatgaggaggagacggaagccaaggccgagctgcagcgcgtgctgtccaaggcc
aactcagaggtggcccagtggaggaccaagtacgagacagatgccatccaaaggaccgag
gaactcgaggaggccaagaagaagctggcccagcggctacaggatgctgaggaggctgta
gaggctgtcaatgccaagtgctcgtcactggagaagaccaagcaccggctgcagaatgag
atcgaggatctcatggtggacgtggagcgctccaatgccgccgctgcagccctggacaag
aagcagaggaacttcgacaagatcctggccgagtggaagcagaagtatgaggagtcacag
tcagagctggagtcctcacagaaggaggcgcggtccctcagcacggagctcttcaagctc
aagaacgcctacgaggagtccctggagcacctggagaccttcaagcgagagaacaagaat
ctccaggaggagatctcggacctgactgagcagctgggctccagtggaaagaccatccat
gagctggagaaggtccggaagcaactggaagcagagaagctggagctgcagtcagccctg
gaggaggctgaggcctccctggagcacgaggaaggcaagatcctccgggcccagctggag
ttcaaccagatcaaggcagagatcgagcggaagctggctgagaaggacgaggagatggag
caggccaagcgcaaccacttgcgtgtggtggactcgctgcagacctccctggatgcggag
acgcgcagccgcaatgaggccctacgagtgaagaagaagatggagggcgacctcaatgag
atggagatccagctcagccacgccaaccgcatggctgctgaagcccagaagcaagccaag
agcctccagagcttgttgaaggacacccagatccagctggatgacgcggtccgtgccaat
gatgacctgaaggagaacattgccatcgtggagcggcgcaacaacctgctgcaggctgag
ttggaggagctacgggctgtggtagagcagacagaaaggtctcggaagctggctgagcag
gagctgatcgagaccagtgagcgggtgcagctgctgcactcccagaacaccagcctcatc
aaccagaagaagaagatggacgcagacctgtcccagcttcagactgaagtggaggaggca
gtgcaggagtgcaggaatgctgaggagaaggccaagaaggccatcacagatgctgctatg
atggcggaggagctgaagaaggagcaggacacgagcgcccacctggagcgtatgaagaag
aacatggagcagaccatcaaggacctgcagcaccgactggatgaggccgagcagatcgcc
ctcaagggcggcaagaagcagctgcagaaactggaggcccgggtgcgggagctggagaac
gagctggaggtcgaacagaagcgcaacgcagagtccatcaagggcatgagaaagagtgag
cgtcgcatcaaggagctcacctaccaggtgcgggcagggcaggtgttctggggccaggct
cttttcatctcggtctga

DBGET integrated database retrieval system