KEGG   Loxodonta africana (African savanna elephant): 100656811
Entry
100656811         CDS       T04351                                 

Gene name
DLG4
Definition
(RefSeq) disks large homolog 4 isoform X6
  KO
K11828  discs large protein 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04390  Hippo signaling pathway
lav04724  Glutamatergic synapse
lav05016  Huntington disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100656811 (DLG4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100656811 (DLG4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100656811 (DLG4)
   05022 Pathways of neurodegeneration - multiple diseases
    100656811 (DLG4)
  09165 Substance dependence
   05030 Cocaine addiction
    100656811 (DLG4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100656811 (DLG4)
Membrane trafficking [BR:lav04131]
 SNARE
  SNARE associated proteins
   Others
    100656811 (DLG4)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    100656811 (DLG4)
SSDB
Motif
Pfam: Guanylate_kin PDZ PDZ_assoc PDZ_6 PDZ_2 MAGUK_N_PEST SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 100656811
NCBI-ProteinID: XP_003416927
LinkDB
Position
Unknown
AA seq 721 aa
MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQASSPPVIVNTDTLEAPGYVNGTEGEMEY
EEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEV
DVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKIMEIKLIKGPKGLGFSIAGGVGNQHI
PGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKV
AKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLG
EEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVN
GVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASL
RSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETD
DIGFIPSKRRVERREWSRLKAKDWGSNSGSQGREDSVLSYETVTQMEVHYARPIIILGPT
KDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQ
YNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINK
RITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARER
L
NT seq 2166 nt   +upstreamnt  +downstreamnt
atggactgtctctgtatagtgacaaccaagaaataccgctaccaagatgaagacacgccc
cctctggagcacagcccggcccacctccccaaccaggccagttctccccctgtgattgtc
aacacagataccctagaggccccgggatatgtgaacgggactgagggggagatggaatac
gaggagattacattggaaaggggtaactcaggtctgggcttcagcatcgcaggtggcact
gacaacccacacattggtgacgacccgtccattttcatcaccaagatcattcctggtggg
gctgcagcccaggacggccgcctcagggtcaatgacagcatcctgtttgtaaacgaagtg
gatgtgcgggaggtgacccactccgcggcagtggaggccctcaaagaggcaggttccatc
gtccgcctttatgtcatgcgccggaagcccccggctgagaagatcatggagatcaagctc
atcaaggggcctaaaggtctcggcttcagcatcgcagggggcgtagggaaccagcacatc
cccggagataatagcatctatgtaacgaagatcatcgaggggggggccgcccacaaggac
gggagattgcagattggggacaagatcctggcggtcaacagcgtggggctggaggacgtg
atgcatgaagatgctgtggcagccctgaagaacacgtatgatgttgtctacctaaaggtg
gccaagcccagcaatgcctacctgagtgacagctatgctcccccagacatcacaacctca
tattcccagcacctggacaatgaaatcagtcacagcagctacctgggcaccgactacccc
acagccatgacccccacctcccctcggcgctactccccagtggccaaggacctgctgggg
gaggaggacattccccgagaaccgaggcggattgtgatccaccggggctccacgggcctg
ggcttcaacatcgtgggtggtgaggacggtgaaggcatcttcatctcctttatcctggcc
ggaggccctgctgacctcagtggagagctgcggaagggggaccagatcctctcggtcaac
ggtgttgatctccgcaatgccagccatgagcaggctgccattgccctgaagaatgcgggt
cagacagttaccatcatcgctcagtataagccagaagagtacagccgcttcgaggccaag
atccacgacctacgggaacagctcatgaatagcagcctgggctcagggacagcctccctg
cgcagcaaccccaaaaggggtttctatatcagggccctgtttgattacgacaagaccaag
gactgcggcttcctgagccaggccctgagcttccgctttggggatgtgctgcatgtgatc
gacgccagtgacgaggagtggtggcaggcgcggcgggtccactctgacagtgagaccgat
gacattggctttatccccagcaagcggcgggtcgagcgacgggagtggtcaaggttaaag
gccaaggattggggctccaactctggatcacagggtcgagaagactcggttctgagctat
gagacggtgacacagatggaagtgcactatgcacgccccatcatcatcctcgggcccacc
aaggaccgtgccaatgacgaccttctctctgagttccccgacaagtttggatcctgtgtt
ccccataccacacggcccaagcgggaatatgagatagatggccgggattaccactttgtg
tcgtcccgggagaaaatggagaaggacattcaagcgcacaagttcatcgaggccggccag
tacaacagccacctgtatgggaccagtgtccagtctgtgcgagaggtggcagagcagggg
aagcactgcatcctcgatgtctcagccaatgctgtgcggcggctgcaggcggcccacctg
caccctatcgccatcttcatccgtccccgctccctggagaatgttctagagattaacaag
aggatcacagaggagcaagcccgaaaagccttcgacagagccaccaagctggagcaggaa
ttcacagagtgcttctcagccatcgtggagggtgacagcttcgaggagatttaccacaag
gtgaagcgtgtcattgaggacctctcaggcccctacatctgggtcccagcccgagagaga
ctctga

DBGET integrated database retrieval system