KEGG   Loxodonta africana (African savanna elephant): 100656926
Entry
100656926         CDS       T04351                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04015  Rap1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04714  Thermogenesis
lav04722  Neurotrophin signaling pathway
lav04723  Retrograde endocannabinoid signaling
lav04728  Dopaminergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04917  Prolactin signaling pathway
lav04926  Relaxin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05205  Proteoglycans in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100656926 (MAPK13)
   04015 Rap1 signaling pathway
    100656926 (MAPK13)
   04370 VEGF signaling pathway
    100656926 (MAPK13)
   04668 TNF signaling pathway
    100656926 (MAPK13)
   04068 FoxO signaling pathway
    100656926 (MAPK13)
   04071 Sphingolipid signaling pathway
    100656926 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100656926 (MAPK13)
   04218 Cellular senescence
    100656926 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100656926 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100656926 (MAPK13)
   04613 Neutrophil extracellular trap formation
    100656926 (MAPK13)
   04620 Toll-like receptor signaling pathway
    100656926 (MAPK13)
   04621 NOD-like receptor signaling pathway
    100656926 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    100656926 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    100656926 (MAPK13)
   04660 T cell receptor signaling pathway
    100656926 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    100656926 (MAPK13)
   04659 Th17 cell differentiation
    100656926 (MAPK13)
   04657 IL-17 signaling pathway
    100656926 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    100656926 (MAPK13)
   04670 Leukocyte transendothelial migration
    100656926 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100656926 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    100656926 (MAPK13)
   04917 Prolactin signaling pathway
    100656926 (MAPK13)
   04926 Relaxin signaling pathway
    100656926 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    100656926 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100656926 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    100656926 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    100656926 (MAPK13)
   04722 Neurotrophin signaling pathway
    100656926 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100656926 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100656926 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    100656926 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100656926 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100656926 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100656926 (MAPK13)
   05020 Prion disease
    100656926 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    100656926 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100656926 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100656926 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100656926 (MAPK13)
   05135 Yersinia infection
    100656926 (MAPK13)
   05133 Pertussis
    100656926 (MAPK13)
   05152 Tuberculosis
    100656926 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100656926 (MAPK13)
   05161 Hepatitis B
    100656926 (MAPK13)
   05171 Coronavirus disease - COVID-19
    100656926 (MAPK13)
   05163 Human cytomegalovirus infection
    100656926 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100656926 (MAPK13)
   05169 Epstein-Barr virus infection
    100656926 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100656926 (MAPK13)
   05140 Leishmaniasis
    100656926 (MAPK13)
   05142 Chagas disease
    100656926 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100656926 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100656926 (MAPK13)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100656926 (MAPK13)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100656926 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 APH Kdo Kinase-like DUF4023
Other DBs
NCBI-GeneID: 100656926
NCBI-ProteinID: XP_003404273
UniProt: G3SVM7
LinkDB
Position
Unknown
AA seq 366 aa
MSLTRRKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEMFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFTEEKIQYLMYQTLKGLKYIHSAGVIHRDLKPGNLAVNEDCELKILDFGLARHADTEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLNDKAAKSYIQSLPQSPKKDFSQLFPRASPQAIDLLEKMLELDVDKRLTAS
QALTHPFFEPFRDPEEETEAEQPFDESLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcctcacccggagaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtaggcagcggggcctatggagccgtgtgc
tctgccatcgacaagcggtcaggggagaaggtagccatcaagaagctgagtcggcccttc
cagtctgagatgtttgccaagcgggcctatcgggagctgttgctgctgaaacacatgcaa
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacggatctgcagaagatcatggggatg
gagttcaccgaggaaaagattcagtacctgatgtatcagactctcaagggtcttaagtac
atccactcagctggagtcatccacagggacctgaagccaggcaacctagctgtgaatgag
gactgcgaattgaagatcctggattttgggctggcacggcacgcggacactgagatgact
ggctatgtggtgacccgctggtaccgggcccctgaggtgatcctcagctggatgcactac
aaccagactgtagacatctggtctgttggttgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagactacctggaccagctgacccagatcctgaaagtgaccggg
gtgcctggcgcagagtttgtgcagaagcttaacgacaaggcggccaaatcctacatccag
tccctgccacagagtcctaagaaggatttctctcagctcttcccacgtgccagccctcag
gccatagacctgcttgagaagatgctggagctggatgttgacaagcgcctgacagcctcg
caggccctcacccaccccttctttgaacccttccgggaccctgaggaggagacggaggcc
gagcagccatttgatgaatccttagagcatgagaagctcacagtggatgaatggaagcag
cacatctacaaggagatcgtgaacttcagccctatcgcccgcaaggactcacggcggcgg
agtggcatgaagctgcagtga

KEGG   Loxodonta africana (African savanna elephant): 100661039
Entry
100661039         CDS       T04351                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04015  Rap1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04714  Thermogenesis
lav04722  Neurotrophin signaling pathway
lav04723  Retrograde endocannabinoid signaling
lav04728  Dopaminergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04917  Prolactin signaling pathway
lav04926  Relaxin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05205  Proteoglycans in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100661039 (MAPK12)
   04015 Rap1 signaling pathway
    100661039 (MAPK12)
   04370 VEGF signaling pathway
    100661039 (MAPK12)
   04668 TNF signaling pathway
    100661039 (MAPK12)
   04068 FoxO signaling pathway
    100661039 (MAPK12)
   04071 Sphingolipid signaling pathway
    100661039 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100661039 (MAPK12)
   04218 Cellular senescence
    100661039 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100661039 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100661039 (MAPK12)
   04613 Neutrophil extracellular trap formation
    100661039 (MAPK12)
   04620 Toll-like receptor signaling pathway
    100661039 (MAPK12)
   04621 NOD-like receptor signaling pathway
    100661039 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    100661039 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    100661039 (MAPK12)
   04660 T cell receptor signaling pathway
    100661039 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    100661039 (MAPK12)
   04659 Th17 cell differentiation
    100661039 (MAPK12)
   04657 IL-17 signaling pathway
    100661039 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    100661039 (MAPK12)
   04670 Leukocyte transendothelial migration
    100661039 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100661039 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    100661039 (MAPK12)
   04917 Prolactin signaling pathway
    100661039 (MAPK12)
   04926 Relaxin signaling pathway
    100661039 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    100661039 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100661039 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    100661039 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    100661039 (MAPK12)
   04722 Neurotrophin signaling pathway
    100661039 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100661039 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100661039 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    100661039 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100661039 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100661039 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100661039 (MAPK12)
   05020 Prion disease
    100661039 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    100661039 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100661039 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100661039 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100661039 (MAPK12)
   05135 Yersinia infection
    100661039 (MAPK12)
   05133 Pertussis
    100661039 (MAPK12)
   05152 Tuberculosis
    100661039 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100661039 (MAPK12)
   05161 Hepatitis B
    100661039 (MAPK12)
   05171 Coronavirus disease - COVID-19
    100661039 (MAPK12)
   05163 Human cytomegalovirus infection
    100661039 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100661039 (MAPK12)
   05169 Epstein-Barr virus infection
    100661039 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100661039 (MAPK12)
   05140 Leishmaniasis
    100661039 (MAPK12)
   05142 Chagas disease
    100661039 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100661039 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100661039 (MAPK12)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100661039 (MAPK12)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100661039 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 100661039
NCBI-ProteinID: XP_023398398
LinkDB
Position
Unknown
AA seq 259 aa
MPFMGTDLGKLMKHEKLSEDRIQFLVYQMLKGLKYIHAAGIIHRDLKPGNLAVNEDCELK
ILDFGLARQADSEMTGYVVTRWYRAPEVILNWKHYTQTVDIWSVGCIMAEMITGKTLFKG
NDHLDQLKEIMKVTGTPSAEFVQGLQSADAKNYMKGLPELEKKDFASILTNASPLAVNLL
EKMLVLDAEQRVTAAEALAHPYFEALHEAEDEPTPQKYDDSFDDVDRTLDEWKRVTYKEV
LSFKPPRQLGSRASKETAL
NT seq 780 nt   +upstreamnt  +downstreamnt
atgccgttcatgggcaccgacctgggcaagctcatgaagcacgagaagctgagtgaggac
cgcatccagttccttgtgtaccagatgctgaaggggctcaagtacatccatgctgctggt
atcatccacagggacctcaagcccggcaacctggcggtgaacgaggactgtgagctaaag
atcctggactttggcctggccagacaggcagacagtgagatgaccggatacgtggtgacc
cggtggtaccgggcaccagaagtcatcctgaactggaagcactatacacagacagtcgac
atttggtcggtgggctgcatcatggccgagatgatcaccgggaagacgctgtttaagggc
aatgaccacctggatcagctgaaggagatcatgaaggtgacgggaacaccctcggctgag
tttgtgcaggggctgcagagtgccgacgctaagaactacatgaagggacttcctgagctg
gagaagaaggactttgcgtccatcctgaccaacgccagtcccctcgccgtgaacctcctg
gagaagatgctggtgctggatgcggagcagcgggtgacagcggctgaggcgctggcccac
ccctacttcgaggccctgcatgaggcagaggacgagcctacgccacagaagtacgatgac
tcctttgacgatgtagaccggacgctggatgagtggaagcgtgtcacctataaagaggtg
ctcagcttcaagcctccccggcagctggggtcgagggcttccaaggagacagctctgtga

KEGG   Loxodonta africana (African savanna elephant): 100673331
Entry
100673331         CDS       T04351                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04015  Rap1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04370  VEGF signaling pathway
lav04380  Osteoclast differentiation
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04670  Leukocyte transendothelial migration
lav04714  Thermogenesis
lav04722  Neurotrophin signaling pathway
lav04723  Retrograde endocannabinoid signaling
lav04728  Dopaminergic synapse
lav04750  Inflammatory mediator regulation of TRP channels
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04917  Prolactin signaling pathway
lav04926  Relaxin signaling pathway
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05014  Amyotrophic lateral sclerosis
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05133  Pertussis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05205  Proteoglycans in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100673331 (MAPK14)
   04015 Rap1 signaling pathway
    100673331 (MAPK14)
   04370 VEGF signaling pathway
    100673331 (MAPK14)
   04668 TNF signaling pathway
    100673331 (MAPK14)
   04068 FoxO signaling pathway
    100673331 (MAPK14)
   04071 Sphingolipid signaling pathway
    100673331 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100673331 (MAPK14)
   04218 Cellular senescence
    100673331 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100673331 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100673331 (MAPK14)
   04613 Neutrophil extracellular trap formation
    100673331 (MAPK14)
   04620 Toll-like receptor signaling pathway
    100673331 (MAPK14)
   04621 NOD-like receptor signaling pathway
    100673331 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    100673331 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    100673331 (MAPK14)
   04660 T cell receptor signaling pathway
    100673331 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    100673331 (MAPK14)
   04659 Th17 cell differentiation
    100673331 (MAPK14)
   04657 IL-17 signaling pathway
    100673331 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    100673331 (MAPK14)
   04670 Leukocyte transendothelial migration
    100673331 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100673331 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    100673331 (MAPK14)
   04917 Prolactin signaling pathway
    100673331 (MAPK14)
   04926 Relaxin signaling pathway
    100673331 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    100673331 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100673331 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    100673331 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    100673331 (MAPK14)
   04722 Neurotrophin signaling pathway
    100673331 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100673331 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100673331 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    100673331 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100673331 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100673331 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100673331 (MAPK14)
   05020 Prion disease
    100673331 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    100673331 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100673331 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100673331 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100673331 (MAPK14)
   05135 Yersinia infection
    100673331 (MAPK14)
   05133 Pertussis
    100673331 (MAPK14)
   05152 Tuberculosis
    100673331 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100673331 (MAPK14)
   05161 Hepatitis B
    100673331 (MAPK14)
   05171 Coronavirus disease - COVID-19
    100673331 (MAPK14)
   05163 Human cytomegalovirus infection
    100673331 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100673331 (MAPK14)
   05169 Epstein-Barr virus infection
    100673331 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100673331 (MAPK14)
   05140 Leishmaniasis
    100673331 (MAPK14)
   05142 Chagas disease
    100673331 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100673331 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100673331 (MAPK14)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100673331 (MAPK14)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100673331 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 100673331
NCBI-ProteinID: XP_003403994
UniProt: G3SVM3
LinkDB
Position
Unknown
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cctgagcgctatcagaacctgtccccggtgggctccggtgcctatggctcggtatgtgct
gcttttgacacaaaaactgggttacgtgtggcagtgaagaagctctccagaccatttcag
tccattattcatgccaaaaggacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggatgtatttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatcttatgggggcagatctgaacaacattgtaaaatgtcag
aagcttacggatgaccacgtacaattccttatctaccaaattctccgaggcctaaagtat
atacattcagccgacataattcacagggacctaaagcctagtaatctagctgtgaacgaa
gactgtgagctgaagatcctggattttggcctggctcggcacacagacgacgaaatgaca
ggctatgtggccaccaggtggtacagggctcccgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactacattcag
tctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtgttggactcagataagagaatcacagcagcc
caagccctcgcgcatgcttactttgctcagtaccatgaccccgatgatgagccggtggca
gatccttacgaccagtccttcgaaagcagggacctcctgatagatgagtggaaaagcctg
acctacgatgaagtcatcagttttgtgccaccaccccttgaccaagaagagatggagtcc
tga

DBGET integrated database retrieval system