KEGG   Loxodonta africana (African savanna elephant): 100656983
Entry
100656983         CDS       T04351                                 

Gene name
DYNC2H1
Definition
(RefSeq) LOW QUALITY PROTEIN: cytoplasmic dynein 2 heavy chain 1
  KO
K10414  dynein heavy chain 2, cytosolic
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04962  Vasopressin-regulated water reabsorption
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100656983 (DYNC2H1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100656983 (DYNC2H1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100656983 (DYNC2H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100656983 (DYNC2H1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100656983 (DYNC2H1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      100656983 (DYNC2H1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     100656983 (DYNC2H1)
SSDB
Motif
Pfam: AAA_6 DHC_N2 AAA_9 Dynein_C AAA_lid_11 AAA_5 AAA_8 Dynein_heavy DHC_N1 AAA_7 MT AAA_22 AAA_16 RsgA_GTPase ABC_tran AAA AAA_24 AAA_30 AAA_28 AAA_18 AAA_29 RNA_helicase ATPase_2 IstB_IS21 AAA_33 AAA_23
Other DBs
NCBI-GeneID: 100656983
NCBI-ProteinID: XP_023410473
LinkDB
Position
Unknown
AA seq 4326 aa
MAGGIGDVRKLFIFTTTQNYFGLMSEPRDQPLLYDCPEINNFLDDGNQMLLRVQRSDSGI
SFSNMIDFGDTKDKVLVFFKLRPEVITDQNLHNNILVSSMLESPINSLYQAVRQVFAPVL
LKDQEWSRNFDPKLQNLLSELEAGLGIVVRRSDINSSKMKFKEDDTRGILTPSDEFQFWI
EQAHRGNRQISKERASYFKELFETIAREFYNLDNLSLLEVVDLVETTRDVVDDVWRQTDH
DHYPESRMLHLLDITGGSFGRFVQKKLGTLNLWEDPYYLVKENLKAGISICEQWVIACNH
LTGQVWQRYVPHPWKNEKYFPETLDKLGKRFEEILAIRTIHEKLLYFLPASEEKIICLTR
VFEPFTGLNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDSPQQLLQA
FLKYKELVKRPTISKELMLERETLLARLVDSVKDFRLDFETRCRGIPGNASGPLSGKNLS
EVVNNIVWVRQLELKVDDTIKIAEALLSDLSGFRSFHRSAEDLSDQFKLYEQEQFDDWSR
DIQSGLSDSRSGFCIEANSRIMELDPNDGSLKVHYSDRLVVLLREVRQLSALGFVIPAKI
QQVANIAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGNGGK
SQITWDNPKELEGYIQKLQNAAERLATENRKLRKWHTTFCEKVVVLMNIDLLRQQQRWKD
GLQELRTGLASVEAQGFQASDMRAWKQHWNHQLYKALEHQYQMGLEALNEDLPEINIDLT
YKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEAGDESIFSVMIDRNASGFLTIF
SKAEDLFRRLSAVLHQHKEWIVIGQVDMEALVEKHLFTVHDWEKNFKALKIKGKEVERLP
SVVKVDCLNINCNPVKTVIDDLIQKLFDTLVLSLRKSIQAHLHEIDTFVTEAVEILTIMP
QSVEEIGDANLRYSKLQEQKPEILPLFQEAEDKNRLLRTVAGGGLEAISNLKAKWDKFEL
MMESHQLMIKDQIEVMKGNVKSRLHIYYQELEKFKARWDQLKPGDDAIETGQQNTLDKSA
ESIKEKKIEFDELEVIRKKLVDDCHHFGLEEPNFSLAYSISKDIESCAQVWALYEEFHQG
FQEMADEDWITFRTKTHLFEEFLVDWHDRLRKVEEHSVMTVKLQSEIDKYKIAVPVLKYV
RGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLIKVADTIVAKASDLKDLNSRAQGEVTI
REALRELDLWGVGAVFTLIDYEDSQSRTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKG
FEDKVSIWERKLAELDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNRVDEDFRSIMT
DIKRDNRVTTLTSHAGIRNSLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEI
LGQSTNPSVIQSHLKKLFAGINSVCFDEESKHIIAMKSLEGEVVPFKNKVLLSPLMETWL
NGLSLEMKETLKQLLKECVTTGRSSQGAIDPSLFPSQILCLAEQIKFTEDVENAIKDHSL
HQIETQLVNKLEHYTNIDTGSEDPGNTEYGILELKLKALILDIIHNIDVVKQLNQVQIHT
TEDWAWKKQVRFYMRSDHMCYVQMVDSELQYTYEYQGNAPKLVYTPLTDKCYLTLTQAMK
MGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCF
DEFNRLEESVLSAVSMQIQTIQDALKNHRTVCELLGKEVEINSNSGIFITMNPAGKGYGG
RQKLPDNLKQLFRPVAMSRPDNELIAEVILYSEGFKDAKVLGRKLVAIFNLSRELLTPQQ
HYDWGLRALKTVLRGSGNLLRQLKKNGTKQNVNESHIVVQALRLNTMSKFTFTDCTRFDA
LIKDVFPGIDFKEVEYEDLSAALKQVFEEANYEIIPNQIKKALELYEQLRQRMGVVIVGP
SGAGKSTLWRMLRAALCKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQ
VVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLS
CASPATISRMGMIFLSDEETDLNSLIKSWLRNQPAKYRNNLENWIGDYFEKALQWVLKQN
DYVVETSLVGTAMNGLSHLHGCKYHEQFIVNLIRGLGGNLNMKSRLEFTKEVFNWARESP
PDAHKPMDTFYDSSKGRLASYVLKKPDNLTADDFSNGQTLPVIQTPDMQRGLDYFKPWLS
SNTKQPFILIGPEGCGKGMLLRYAFSQLRSTQIATVHCSAQTTSRHLLQKLSQTCMVIST
NTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENI
QIVASMSAGGRLGRHKLTTRFTSIVRLCAVDYPEREQLQTIYGAYLEPVLHKNLKNHSIW
GSPSKIYLLAGSMVQVYEQVRAKFTVDDYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPL
DYVLEIVAYEARRLFRDKIVGAKELHLFDGILTSVLQGDWGSDILDNMADSFYVTWGARH
SSGARAAPGQPLPPHGKPLGKLNSADLKDVIKKGLIHYGRDNQNLDILLFQEVLEYMSRI
DRVLSFPGGSLLLAGRSGVGRRTITSLVSHMHGAVLFSPKISRGYELKQFKNDLKHVLHL
AGIEAQQVVLLLEDYQFVHPTFLEMINSLLSSGEVPGLYTLEELEPLLLPLKDQASQDGF
FGPIFNYFTYSKRAKQTKIPALMEFTFLWGLYEKSFPDKDPEKRACLMILRITKRPVYLE
QSDFRERVVGDEARDIPEMLLSETGSEEKYSDKKRKEEKKKNSVDPDFLKSFLLIHESCK
AYGATPSRYMTFLHVYSAISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGDKCV
TXTKQDEAXTLLKEISVSLFFIQDASEQKTELERLKHKIAEEVVKIEERKNKIDDELKEV
QPLVNEAKLAVGNIKPESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKR
GVREDIATFDARNIPKEIRESVEELLFKNKGSFDPKNAKRASTAAAPLAAWVKANVQYSH
VLERIQPLETEQAVLESNLKKTEDRKRKLEELLNSVGQKVSELKEKFQSRTSEAAKLEAE
VSKAQETIKAAEVLINQLDREHKRWNAQVAEIAEELATLPKRAQLAAAFITYLSAAPEDL
RKTCLEEWTKSAGLEKFDLRRFLCTESEQLIWKSEGLPSDDLSIENALVILQSRVCPFLI
DPSSQATEWLKTHLKDSRLEVINQQDNNFITALELAVRFGKTLIIQEMDGVEPVLYPLLR
RDLVAQGPRYVVQIGDKIIDYNEEFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRG
QLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLAKLEESLLETLATSQGNILENKDLIESL
NQTKASSALIQDSLKESYKLQIFLDQERDAYLPLAESASKMYFIISDLSKINNMYRFSLA
AFLRLFQRALQNKQDSENTEQRNRSLINSLKHMVYEYICRCLFKADQLMFALHFVRGMYP
ELFQENEWDTFTGVVVGDMLRKADSQQRIRDQLPSWIDQERNWAVATLKIALPSLYQTLC
FEDAALWRTYYHNSMCEQEFPSILAKKVSLFQQVLVVQALRPDRLQSAMALFACKTLGLK
ELSPLPLNLKRLYRETLEIEPILIIISPGADPSQELQELANAERSRECYHQVAMGQGQAD
LAVQMLKECARNGDWLCLKNLHLVVSWLPVLEKELNTLHPKDTFRLWLTAEVHPNFTPIL
LQSSLKITYESPPGLKKNLMRTYESWTPEQISKKDNIHRAHALFSFAWFHAACQERRNYI
PQGWTKFYEFSLSDLRAGYNIIDRLFDGTKDVQWEFVHGLLENAIYGGRIDNYFDLRVLQ
SYLKQFFNSSTIDGLSQRDKKSIFPYSVSLPKSCSILDYRAVIEQLPEDDKPSFFGLPAN
IARSSQRMISSQVISQLRILGRSVTAGCKFDREIWSNELSPVLNLWKKLNQSSNLIHHKV
SPPNDRQGSPILSFIVLEQFSAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLANALLNQ
KCPLMWQSKWEGPEDPLQYLRGLVARALAIQNWVEKAEKQALLSETLDLSELFHPDTFLN
ALRQETARAMGRSVDSLRFVASWKGRLQEAKLQIKISGLLLEGCSFDGNRLSENQHDSPS
VSSVLPCFVGWIPQDAYGPYSPDECISLPVYTSAERDRVVTNIDVPCGGNQDRWIQCGAA
LFLKNQ
NT seq 12981 nt   +upstreamnt  +downstreamnt
atggcgggcgggattggggacgttcggaagcttttcatcttcactactacccagaactac
ttcggattgatgtcggaacccagagatcagcccctactgtacgactgtcctgaaatcaac
aacttcttggatgacggaaaccagatgctcctcagggtgcagcgatctgactccggaatc
tccttttccaacatgattgattttggtgacacaaaagataaagtgttggtgtttttcaag
ctgcgacctgaagtaattaccgaccaaaatctacataataacattcttgtttcatctatg
ttagagtcacctattaactctctttatcaagcagtacgacaagtatttgcaccagtcttg
ttaaaggatcaggaatggagcagaaactttgatcccaagcttcagaatcttttgagtgaa
ttagaagctggattgggcattgttgtgcgaagatcagacattaactcatcaaaaatgaag
tttaaggaggatgacacacgaggtattcttaccccaagtgatgaattccagttttggata
gaacaagctcatcgtggaaatagacaaattagtaaagaaagagccagttattttaaagaa
ttatttgaaacaattgcaagagagttttataacttggacaacctatccttattggaagtt
gttgacttggtggagactactcgggatgttgttgatgatgtgtggagacagacagaccac
gatcattatcctgagtcccgaatgttacatctcttggacatcacaggtggctcatttgga
aggtttgttcagaaaaagttgggaacattgaacctatgggaagatccttattatcttgtg
aaagaaaatctgaaagctggtatttcaatttgtgaacagtgggtgatagcttgtaatcat
ctaacaggtcaagtgtggcagcgctatgttcctcatccatggaaaaatgaaaaatatttc
cctgaaacacttgacaaacttggcaaacgctttgaagagatcttggctattagaacaatt
catgagaagctcctctatttcttacctgccagtgaagagaaaattatatgcctgactcga
gtatttgagccttttactggcctgaatcctgtgcaatataatccatacactgagcctttg
tggaaagccgcagtctctcaatacgaaaaaattattgcacccgcagaacaaaaaatagca
ggaaaattgaaaaattatatttcggaaattcaagatagtccacagcagcttcttcaagca
tttctgaaatacaaagagttggtgaagcgtccaactataagcaaagaattgatgttagaa
agagaaactttactggcaagacttgtggactcagttaaagattttcgattagactttgag
actcggtgccgaggaattcctggtaatgcatctggaccactttctggcaaaaatctttca
gaagttgtcaataatattgtttgggttcgccagttggagctgaaggtagatgatactatc
aagattgcagaagctcttttatctgacttgtcgggatttcgatcttttcatcgaagtgct
gaagatctttcagatcagtttaagctttatgaacaagaacaatttgatgattggtccaga
gatattcagtcgggtttgtctgattccagatctggtttttgtattgaggctaatagtcga
attatggaattggatcctaatgatggatcattaaaagtgcattattcagatcgtttggtt
gttcttctgagagaagtacgtcagctttctgcacttgggtttgttattcctgccaaaata
cagcaagtcgcaaacattgcacagaaattctgcaagcaagcaattattcttaaacaagtg
gcacatttttacaattctattgaccaacaaatgatacaaagccagagaccaatgatgtta
cagtctgccttagcatttgaacaaataattaagaattcaaaagcgggaaatgggggaaag
tcacagattacttgggataatcctaaagaattagaaggctacattcaaaagctccaaaat
gctgctgaacgacttgccactgaaaatagaaaactgagaaaatggcacactacgttttgt
gaaaaggtggtagttcttatgaatattgatctgcttcggcagcaacagcgttggaaagat
ggactgcaagaactgagaactggtttagcaagtgtagaagcacagggattccaagcaagc
gacatgcgcgcatggaagcagcactggaatcatcaactgtacaaagccctggagcatcag
tatcagatgggcctggaggcgcttaatgaggacctaccggaaataaacatcgacctgact
tacaaacagggacggttacagttcaggcctccgtttgaagaaatccgggctaaatattat
agagaaatgaagagattcattggcattccaaatcagtttaagggagtgggtgaagcagga
gatgaatctattttttctgtgatgattgatagaaatgcaagtggatttctgactattttc
agcaaggcggaagatctgtttagaagattgtcagctgttttacaccaacataaggagtgg
attgtaatcgggcaagttgatatggaagctttggtggaaaaacatctcttcactgtacat
gattgggaaaagaattttaaagcactgaaaataaaagggaaagaagtagaacgacttcca
agtgtcgtcaaggtggactgtttaaatatcaattgtaaccctgtgaagactgtgattgat
gatctcatccagaagttatttgatacacttgttctttctttgaggaaatccattcaggct
catttacatgaaattgatacatttgttactgaggctgtggaaatcttaacaattatgccc
cagtctgtggaagaaataggtgatgcaaatttgcgatatagtaagctacaagaacagaag
ccagagattttgcccttatttcaagaagctgaagataaaaacagacttttacgaactgtg
gcaggtggaggtttagaagcaattagtaatctgaaagctaagtgggataaatttgagttg
atgatggaaagtcaccagcttatgattaaagatcagattgaagtgatgaaaggaaatgta
aaatcacgtcttcacatctactatcaagaactggaaaaattcaaagctcgttgggatcaa
ctaaagcctggtgatgatgctattgaaactgggcagcaaaatactcttgataaaagtgca
gagtcaataaaggagaaaaaaattgagtttgatgaacttgaagtcataaggaaaaagctg
gttgatgattgccatcattttggattagaagagcccaacttctccctggcgtatagcatc
tctaaagatattgagagctgtgcgcaagtttgggccctttatgaagagttccatcaagga
ttccaagaaatggctgatgaagattggattactttccggactaagacacacctatttgag
gaatttttggtggattggcatgacagattaaggaaggttgaggaacattcagtaatgact
gtgaaattacaatcagaaattgacaagtataaaattgcagttcctgtactgaagtacgtc
cgaggggagcatctctctccagatcactggctcgaccttttccgcctccttggccttcct
aggggaactagtctagagaaattattgtttggagatctgatcaaagtagctgatacaatt
gtagccaaagcttcagaccttaaagatttaaatagtcgggcacaaggtgaagttacaatc
agagaagctttacgtgaacttgatctctggggagttggagcagtgtttacactgattgat
tatgaagacagccaaagtcgaaccatcaagctgattaaagactggaaagatatagtaaat
caggttggggataaccgatgccttcttcaatccttaaaggattctccttattataaagga
tttgaagataaagtatcaatttgggaaagaaaacttgcagagttagatgaatacctgcag
aatttgaatcatattcaaaggaagtgggtgtatttggaacccatttttggccgtggagca
ttgccaaaagagcagacacgtttcaacagagttgatgaagattttagatcaataatgact
gacatcaagagagacaatagagtaacaacgttaactagtcatgcaggaatcaggaattct
ttactaactatacttgatcagcttcaaagatgtcaaaaatcattgaatgaatttttggag
gaaaaacgctcagcattcccaagattttattttattggtgatgatgatttgttagaaata
ctgggccagtctactaacccatcagtgattcagtctcaccttaagaagctgtttgcaggt
attaacagtgtatgctttgatgaggaatcaaagcatataattgcaatgaaatctttagag
ggagaagttgtgccttttaaaaataaagttctcctgtcacctcttatggagacttggtta
aatggtttatccttggaaatgaaagaaactttgaaacagttgttgaaggaatgtgttact
actgggagaagttctcaaggtgcaattgacccatctctcttcccttcgcagatattatgt
ttggcagaacagattaaattcactgaagatgtagaaaatgctatcaaggatcatagtctt
catcagattgaaacacaactggtgaataagttagagcattacactaacattgatacaggt
tctgaggatccagggaatactgaatatggcattctggagcttaaacttaaagcattaatt
cttgacattattcataatattgatgtggtgaagcagttgaaccaggttcaaattcataca
actgaagactgggcttggaaaaaacaagttagattctatatgagaagtgatcacatgtgc
tatgttcaaatggtggattctgaacttcagtatacttacgagtatcagggtaatgctccc
aagctggtttatactccattgacagataagtgctacttaactctcactcaagccatgaag
atgggactaggaggaaatccttacggaccagcaggaactggaaaaactgaatcagtaaag
gctttaggtggacttcttggaagacaagttttagtgtttaattgtgatgagggcatcgat
gtgaagtcaatggggcgaatatttgttggtttggtgaagtgtggggcctggggttgtttt
gatgaattcaatagactggaagaatctgtactgtctgcagtatctatgcaaatccagaca
atccaggatgccctgaagaaccatagaactgtatgtgaattacttggcaaggaggtagaa
ataaattctaattctggaatttttatcactatgaatcctgctggaaaaggctatggagga
agacaaaaactgcctgataatcttaagcagcttttcaggccagtagcaatgtctcgtcca
gacaatgagcttattgcagaagttattctctattcggaaggatttaaagatgctaaagta
ttgggcagaaaattggtagctattttcaatctatctagggaacttttgacacctcagcaa
cattacgattggggcttaagagctttgaagacagttctgagaggaagtggaaatctcctt
agacagctgaagaaaaatggcactaaacagaatgttaatgaaagtcatattgtggtacaa
gcattgcggcttaatacaatgtcgaagttcacgtttactgattgcacccggtttgatgca
ctgattaaagatgtctttcctggaattgactttaaagaagtagaatacgaagacctaagt
gctgcattaaagcaagtctttgaggaggccaactacgaaatcatacccaatcagatcaag
aaggctttggaattgtatgaacagttacgccagagaatgggagtcgttattgttggtcca
agtggtgctggcaaatcaaccctttggagaatgttaagggccgcactttgtaaaattggc
aaagtggtaaaacaatataccatgaatcccaaagctatgcctagacatcaattattaggc
catattgacatggatacaagggaatggtctgatggtgttttgacaaatagtgctcgccaa
gtggttcgagaacctcaagatgtcagctcatggataatctgtgatggtgatattgaccct
gaatggatagaatctctgaattctgtattggatgataatcgtctactcactatgcccagt
ggagaaaggattcagtttggcccaaatgttaactttgtatttgaaactcatgatttaagt
tgtgcctcaccagccacaatatctagaatgggaatgatctttcttagtgatgaagagacg
gatcttaattctctgataaaatcgtggttgaggaatcagcctgctaaatataggaataat
cttgaaaactggattggagattattttgaaaaggctttacagtgggttttaaagcagaat
gattacgtggtagaaacaagtttggttgggactgcaatgaatggtttgtcacacctacat
ggatgcaaatatcatgaacaatttattgttaatctcataaggggacttggtggaaatctg
aacatgaaatcacgtctggaattcaccaaggaggtttttaactgggcacgagaatctcct
ccagacgctcataaaccaatggacacattctatgactcaagtaaagggcgattagcatct
tatgtgctgaagaagccagacaacttgactgctgatgatttcagtaatggccaaactctt
cccgtcattcagacgcctgatatgcagcgaggcctagattatttcaaaccttggttaagt
tctaatactaaacagccgtttattctcataggaccagaaggatgtggcaaggggatgctg
ctaaggtatgccttttcccaacttcgatccacgcagatcgctacagttcactgtagtgca
caaactacctctcgacatctcctgcagaaattgagccagacttgcatggtgatcagtact
aatactggccgtgtatacagaccaaaagactgtgaacgacttgttttatacttaaaagat
atcaacctacccaagcttgataaatgggggaccagtacgttggtagctttcctgcagcag
gtattgacatatcaaggattttatgatgaaaatttggaatgggttggtttagagaatatt
cagattgtggcatctatgtccgctggaggaagactgggaagacacaagctcaccaccaga
tttacttctattgttcgtctttgtgctgtagattacccagaaagagagcaattacaaacc
atttatggtgcatatttggaaccagttctacataaaaatttgaagaatcattcgatttgg
ggttctccatcaaaaatttatctcttagcaggatctatggtacaagtgtatgaacaggtg
cgggccaaatttacagttgatgattacagtcactatttctttactccttgcattcttact
cagtgggttcttggcttattcagatatgatttagaaggaggatcctcaaatcatccatta
gattatgtgttagaaattgtagcatatgaagcacgccgcttatttcgtgacaaaattgtt
ggtgcgaaggaacttcatttatttgacggcattttaacttcagtgcttcaaggagattgg
ggctcagatatattagacaatatggcagatagtttctatgtcacatggggagcccggcat
agttcaggtgccagagcagccccaggacaaccattgcctccacatggaaaaccgcttgga
aaactaaactctgcagatctcaaggatgttattaaaaagggtcttattcattatggacga
gataaccagaatttagatattttacttttccaagaagtcctggagtatatgtctaggata
gatagagtgctgagtttccctggaggttcacttctgttagcaggacgcagtggtgtaggt
cgtcggacaatcacttctttagtcagtcatatgcatggagcagtgctgttttctccaaag
atttccaggggctatgagctgaagcagttcaaaaatgatctcaaacacgtactgcatctt
gcaggtattgaagcacaacaggtagttttacttcttgaagactaccagtttgtacatccc
acatttttggagatgatcaatagtcttttgtcttcaggtgaagttcctggactctatact
ctggaagaattagagcccttgctgttgcctcttaaagatcaagcttcacaggatggcttt
tttggacccatcttcaattacttcacatacagtaaaagagcaaaacaaacaaaaatccct
gcccttatggagtttacattcttatggggactctacgagaaaagcttcccagacaaggat
cctgagaaaagagcctgccttatgattctcaggatcactaagaggccagtttacctggag
caaagtgatttcagggagagagtagttggagatgaggccagagatatacctgaaatgtta
ctcagtgaaacaggtagtgaagaaaaatattctgacaaaaaaaggaaagaagaaaagaaa
aaaaattcagttgatcctgattttctaaaatcatttttattaatccatgagtcttgtaaa
gcatatggtgctacaccaagccgatatatgacatttttacatgtgtattctgccattagt
agcagcaagaaaaaggaattattgaaaagacaaagtcatttacaggctggtgtatctaaa
ctaaatgaagctaaagctcttgtggatgaattgaacagaaaagctggagacaagtgtgtt
acttaaactaagcaagatgaagcnngaacccttttaaaggagatttctgtgagcttgttc
ttcatacaggatgctagtgaacaaaaaacggaactagaaagactaaagcacaagatagca
gaagaagttgttaaaattgaagaaagaaaaaataaaattgatgatgaattaaaagaagta
cagcctttagtcaatgaagctaagctagcggttggaaacattaagccagaatctctttca
gaaattcgctcactacgcatgccacctgatgtaatcagagacattcttgaaggagtctta
aggttgatgggtatctttgatacatcttgggtgagcatgaaaagtttccttgcaaaaaga
ggtgtaagagaagacattgcaacttttgatgcccgaaatattccaaaggaaatcagagag
agtgtcgaagaactgctttttaaaaataagggatcttttgatccgaagaatgcgaagcgt
gccagcactgccgctgcgcctttggccgcctgggttaaagctaacgtccagtactcccat
gtcctggagcggattcagcctttggagactgagcaggcagtgttagaatccaatttgaag
aaaacagaagacagaaaaaggaaactagaggagcttcttaattctgtcggtcaaaaagta
tccgagctcaaagagaaatttcagagcaggacttcagaagctgccaaacttgaagctgaa
gtaagcaaagcacaggaaacaattaaagctgcagaagtcttaattaatcagcttgataga
gaacacaagagatggaatgcacaggttgcagagatagccgaagaattagctactcttcct
aaaagagctcagctagctgctgcatttattacgtacctttctgctgctcctgaggacctg
agaaaaacctgtttggaagaatggactaaatcagctggccttgaaaaatttgatctgagg
agatttctttgtacggaaagtgagcagttaatttggaaaagtgaaggcctaccatcagat
gacctttccatagaaaatgctcttgttatcttacagagtcgagtatgcccgtttcttata
gacccttcttcccaagctaccgaatggttaaagacacatttgaaagactcacgtttggaa
gttattaatcagcaggataataactttatcacagctcttgaattggcagtacgttttggg
aaaacccttatcatacaagagatggatggtgtagaacctgttctttatccattgttgaga
agagatcttgttgctcaaggaccacgctatgtggtacaaataggtgacaaaattattgac
tacaatgaagaattccgcctttttttgtcaacaagaaacccaaacccctttattccaccg
gatgcagcttccatcgtcactgaggttaactttactacaacaagaagtggattacgagga
cagcttttggctttaaccattcaacatgagaagcctgatttagaggaacagaaaacaaaa
ctgttacaacaggaagaagataagaaaatacagctagccaagcttgaagagtctcttcta
gagacacttgcaacatctcaaggcaatattttggaaaataaggatttgattgaatctttg
aatcagacaaaagcaagtagtgcacttattcaagattctcttaaagaatcttacaaactc
cagattttccttgatcaagagcgggatgcgtatcttcctctggctgagagtgccagcaag
atgtacttcattatctctgacctgtcgaaaattaataacatgtatcgttttagtttggct
gcatttcttcgacttttccaacgagctctgcaaaacaaacaggattctgaaaatacagaa
cagaggaaccggtctcttatcaactcattaaaacatatggtatatgaatacatatgccgt
tgtctatttaaggctgatcagttgatgtttgcattgcattttgttcgaggaatgtaccct
gaactttttcaagaaaatgaatgggatacatttacaggtgtggttgttggagatatgtta
cggaaagctgactctcagcaaagaatacgtgatcaacttccatcttggatagatcaggaa
agaaactgggcagtggcaacattaaagattgctctccccagtctttatcagaccctctgc
tttgaagatgcagctctgtggcgtacttactatcataattcaatgtgtgagcaagaattt
ccgtctattcttgcaaaaaaagtttccttatttcagcaggttcttgtggtacaggctctc
agaccagacagattgcaaagtgccatggctctatttgcatgtaaaaccctgggactgaaa
gaattgtctccacttcctctaaatctcaaacgtttatacagagagacgctagaaattgaa
cccatcttgattattatttccccgggagctgatccttctcaggaacttcaagaacttgct
aatgctgaaagaagtagagagtgttatcaccaggttgccatgggtcaaggtcaagctgac
ttagcagttcaaatgctaaaagaatgtgcccgtaacggagactggctgtgtttgaagaac
ttacatcttgtagtatcttggctgccagttctggaaaaggaattgaatacccttcatcct
aaagatacctttcgtctttggctcaccgcagaagttcatcccaactttactcctatttta
ctacagtcaagtttgaagataacatatgagtcacctccaggtttaaagaagaatttaatg
cgtacttatgagtcttggactcctgagcaaattagcaaaaaagataatatacatcgagct
catgctctcttcagttttgcatggtttcatgcggcatgtcaagaaagaagaaattatatt
ccacagggttggactaagttttatgagttctctttatcagatcttcgggctgggtataac
attattgacaggctttttgatggtaccaaagatgtacaatgggaatttgtacatggtcta
ctagaaaatgctatttatggtggacgtatagataactattttgatcttagagttcttcag
tcatatctgaagcagttttttaattcttcaacaattgatggattaagccaaagggacaag
aaaagcatttttccatattctgtatctctaccaaaatcctgcagcattttggattaccgt
gctgtcattgaacaacttccagaggatgacaagcccagtttctttggtctgccagccaat
atcgctcgctcatctcagcgcatgataagttctcaggttatttcacagttgaggatcttg
ggcaggtcagtaacagctggctgcaaatttgatagagagatctggtctaatgagctgtct
cctgtcctcaacctttggaagaaactaaaccagagttccaacctgattcatcataaagtg
tctcctcctaatgaccgacaaggatctccaatattatcattcatcgttcttgaacaattc
agtgccattcgtttagtacaaagtgttcatcagtcacttgccgctctcagcaaagtcatc
agaggaactacattattgagttcagaagtacaaaaattggcaaatgctttattaaaccaa
aagtgtcctctcatgtggcagagcaagtgggaaggcccagaagatcccttgcaatacctc
agaggcctggtagctcgtgcccttgcaatacagaactgggtagaaaaagctgaaaaacag
gcccttctctctgagacactggacctatcagaactcttccacccagacacatttctcaat
gctcttcgccaggaaactgcaagggcaatgggccgttctgtggatagtcttaggtttgta
gcatcatggaaaggtcgacttcaagaagcaaagctgcaaattaagatcagtggcttatta
ctggaaggatgcagttttgatggaaatcgactttctgaaaatcagcatgattctcctagt
gtgtcgtcagttcttccttgctttgtgggctggatcccccaggatgcttatggtccatat
tcccctgatgagtgcatatctttgcctgtctacaccagtgcagaacgggatcgtgtggta
accaatattgacgttccatgcggtggcaaccaagaccggtggattcagtgtggagcagct
ctatttctaaaaaatcagtaa

KEGG   Loxodonta africana (African savanna elephant): 100657546
Entry
100657546         CDS       T04351                                 

Definition
(RefSeq) dynein light chain 1, cytoplasmic-like
  KO
K10418  dynein light chain LC8-type
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04962  Vasopressin-regulated water reabsorption
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100657546
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100657546
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100657546
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     100657546
SSDB
Motif
Pfam: Dynein_light DUF3847
Other DBs
NCBI-GeneID: 100657546
NCBI-ProteinID: XP_023408303
LinkDB
Position
Unknown
AA seq 83 aa
MIKNVDTLEKVQQDSVECATQALEKCNVEKDIAARVKKDYDRKYYPTRLCSVGRNFGSYV
AHDSKHFTYFYLGHVAMLLFKSG
NT seq 252 nt   +upstreamnt  +downstreamnt
atgataaaaaatgtggacacgttggagaaggtgcaacaggactcggtggagtgtgctact
caggcattggagaaatgcaacgtagagaaggacattgcagcccgtgtcaagaaggattat
gacaggaagtactaccccacccggctctgcagtgtggggagaaactttggtagttacgtg
gcacatgacagtaagcacttcacctacttctacctgggccatgtggccatgcttctcttc
aaatctggttaa

KEGG   Loxodonta africana (African savanna elephant): 100659457
Entry
100659457         CDS       T04351                                 

Gene name
DYNC1LI2
Definition
(RefSeq) cytoplasmic dynein 1 light intermediate chain 2 isoform X1
  KO
K10416  dynein light intermediate chain 1, cytosolic
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04962  Vasopressin-regulated water reabsorption
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100659457 (DYNC1LI2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100659457 (DYNC1LI2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100659457 (DYNC1LI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100659457 (DYNC1LI2)
   03036 Chromosome and associated proteins [BR:lav03036]
    100659457 (DYNC1LI2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100659457 (DYNC1LI2)
Membrane trafficking [BR:lav04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    100659457 (DYNC1LI2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      100659457 (DYNC1LI2)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     100659457 (DYNC1LI2)
SSDB
Motif
Pfam: DLIC ABC_tran AAA_22 AAA_16 Arf AAA_7 PduV-EutP Roc AAA_24 AAA_29 NACHT Kinesin ATPase G-alpha SRP54
Other DBs
NCBI-GeneID: 100659457
NCBI-ProteinID: XP_023412302
LinkDB
Position
Unknown
AA seq 492 aa
MAPVGVEKKLLLGPNGPAVAAAGDLTTEEEEGQSLWSSILSEVSTRARSKLPSGKNILVF
GEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSIHDEDRDDHTRCNVWILDGDLYHKGLLK
FAVSAESLPETLVIFVADMSRPWTVMESLQKWASVLREHIDKMKIPPEEMRELERKFVKD
FQEYIEPEEGFQGSPQRRGPLTSGADEENVALPLGDNVLTHNLGIPVLVVCTKCDAVSVL
EKEHDYRDEHFDFIQSHLRSFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTIPA
LVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIMKPPVRKLVHDKELAAEDEQ
VFLMKQQSLLAKQPATPTRASESPARGPAGSPRTQGRGGPASVPSASPGTSVKKPDPNIK
NNAASEGVLASFFNSLLSKKTGSPGSPGAGGVQSTAKKSGQKTVLTNVQEELDRMTRKPD
PMVTNSSTENEA
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcgccggtgggggtggagaagaagctgctgctgggccccaacgggccggcagtcgcg
gccgccggtgacctgaccactgaggaggaggagggccagagtttgtggtcctcgatcttg
agtgaagtgtccactcgcgccaggtccaagctgccgtccggcaagaacatcctggttttc
ggtgaagatggttctggtaaaacaacccttatgactaagctacagggagctgagcatggc
aaaaaaggaagaggcctagaatatctctacctcagcatccacgatgaggaccgagatgat
cacacgcgctgcaatgtgtggattctggacggagacctgtaccacaaaggcctgctgaag
tttgctgtttctgctgagtccttgccagagaccctggtcatttttgttgcagacatgtct
aggccttggactgtgatggaatctcttcagaaatgggctagtgttttacgtgagcacatt
gataaaatgaaaattccaccagaagaaatgagagaactggaacggaagtttgtgaaggat
tttcaagagtatattgagcctgaagaaggttttcaaggttccccacagagaagagggcct
ctgacctcaggcgcagatgaagaaaatgttgccctgcctctcggtgacaatgtgcttact
cataacctggggatcccagtattggtggtgtgtacaaagtgtgatgcagtgagtgtcctg
gagaaggagcatgactacagggacgagcactttgacttcatccagtcacaccttcggagc
ttctgcctacagtatggagctgccttgatttacacatcagtgaaggaagagaaaaacctc
gacttgttgtataagtacattgttcataaaacctatggtttccactttaccatacctgcc
ttagttgtggaaaaggatgcagtttttatacccgcaggctgggacaatgaaaagaaaata
gctattttacatgaaaatttcacaacagtgaagccagaagatgcttatgaagacttcatt
atgaaacctcctgtgagaaagctggtccatgacaaagagttggcagcggaggatgagcaa
gtgttcctaatgaagcaacagtcactccttgccaagcagccagccacgcccacaagagct
tccgaatcccctgcaagaggacctgctggttcgccaagaacccagggccggggaggacca
gccagcgtacccagcgcctccccaggcacatcggtaaagaagccagatccaaacatcaaa
aataacgcagcaagtgaaggggtgttggctagtttcttcaacagtctgttgagcaagaag
acaggctctcctggaagtcctggtgccggcggggtgcagagcacagccaagaagtcagga
caaaaaactgtgttgacaaatgttcaggaagaactggatagaatgactcgaaaaccagac
cccatggtaacaaactcttcaacggaaaatgaagcctga

KEGG   Loxodonta africana (African savanna elephant): 100660499
Entry
100660499         CDS       T04351                                 

Gene name
DYNLL2
Definition
(RefSeq) dynein light chain 2, cytoplasmic
  KO
K10418  dynein light chain LC8-type
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04962  Vasopressin-regulated water reabsorption
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100660499 (DYNLL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100660499 (DYNLL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100660499 (DYNLL2)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     100660499 (DYNLL2)
SSDB
Motif
Pfam: Dynein_light Nop Ectatomin
Other DBs
NCBI-GeneID: 100660499
NCBI-ProteinID: XP_003414646
UniProt: G3TCE3
LinkDB
Position
Unknown
AA seq 89 aa
MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtctgaccggaaggcagtgatcaagaatgcagacatgtctgaggacatgcaacaggat
gctgttgactgcgccacgcaggccatggagaagtacaacatagagaaggacattgctgcg
tatatcaagaaggaatttgacaagaaatacaaccctacctggcattgtatcgtgggccga
aattttggcagctacgtcacacacgagacaaagcacttcatctatttttacttgggtcaa
gttgcaatcctcctcttcaagtcaggctag

KEGG   Loxodonta africana (African savanna elephant): 100661369
Entry
100661369         CDS       T04351                                 

Gene name
DYNC2LI1
Definition
(RefSeq) cytoplasmic dynein 2 light intermediate chain 1 isoform X1
  KO
K10417  dynein light intermediate chain 2, cytosolic
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04962  Vasopressin-regulated water reabsorption
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100661369 (DYNC2LI1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100661369 (DYNC2LI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100661369 (DYNC2LI1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100661369 (DYNC2LI1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      100661369 (DYNC2LI1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     100661369 (DYNC2LI1)
SSDB
Motif
Pfam: DLIC Roc
Other DBs
NCBI-GeneID: 100661369
NCBI-ProteinID: XP_003416149
LinkDB
Position
Unknown
AA seq 351 aa
MPSDTLWEIAKAEVEKKGSNGKEGDGVEIGEKSVFFIGSKNGGKTTIILRCLDRDEPPRP
TLALEYTYGRRAKGHNTPKHIAHFWELGGGTSLLDLITIPITSDTLRTFSVVLVLDLSKP
NDLWPTMESLLHVTKSHVDKVIMKLGKTNSKAASEMRQKIWSNLQKDHPDRELIDPFPIP
LVIIGSKYDIFQDFDSEKRKIICKTLRFVAHYYGASLMFTSKSEALLLKIRGVINQLAFG
IDKGKSMCVDQNKPLFITAGLDSLSQIGSPPVPDNDIGKLNAHSPMELWKKVYEKLFPPK
SLHTLKDIKDPARDPQYAEAEVDEMRIQKDQELEQYKRSSAKSWKQIEFDS
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgcccagtgacacactctgggaaattgcaaaagctgaagtggaaaaaaaaggaagtaat
ggcaaagaaggtgatggagttgaaattggagaaaaatctgttttcttcattggcagtaaa
aacgggggaaagactactattattctacggtgtcttgacagggatgagccaccaagacca
accttagctttggaatatacatatggaagaagagcaaaagggcataacacacccaaacat
attgctcacttttgggaactgggtggaggaacctctttattggacttaatcaccatacca
atcacaagtgacaccttacggacattttctgttgttcttgttttggacctttcaaaacct
aatgacctgtggcctaccatggaaagtctgttgcacgtcacaaaaagccacgtagataaa
gtgataatgaaactgggaaagacaaactctaaagcagcttctgaaatgagacagaagata
tggagtaatctgcagaaggaccatccagatcgtgaattgattgacccatttccaataccc
ctggttataattggaagtaaatacgatatttttcaggattttgactctgagaagagaaag
ataatatgcaagacacttcgattcgttgcacattattatggagcatcattgatgtttacc
agtaaatcagaagctttattactaaaaatacgtggagtcatcaaccagttggcatttggc
attgacaaaggcaaatcaatgtgtgtggatcagaataaaccactgtttatcacagcagga
ttggattctttaagtcaaataggatcccctcccgttcctgataatgatattggaaagctt
aatgcccattcaccaatggagctgtggaaaaaagtgtatgaaaagctctttccaccaaag
agtctccacacgctaaaagatatcaaagaccctgcacgagaccctcagtatgctgaagct
gaagttgacgagatgagaattcagaaggaccaggaacttgaacagtacaaaagaagttct
gccaagtcttggaaacaaattgaatttgattcttga

KEGG   Loxodonta africana (African savanna elephant): 100664711
Entry
100664711         CDS       T04351                                 

Gene name
DYNC1I2
Definition
(RefSeq) cytoplasmic dynein 1 intermediate chain 2 isoform X3
  KO
K10415  dynein intermediate chain, cytosolic
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04962  Vasopressin-regulated water reabsorption
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100664711 (DYNC1I2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100664711 (DYNC1I2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100664711 (DYNC1I2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100664711 (DYNC1I2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100664711 (DYNC1I2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      100664711 (DYNC1I2)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     100664711 (DYNC1I2)
SSDB
Motif
Pfam: Dynein_IC2 WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 100664711
NCBI-ProteinID: XP_010601135
LinkDB
Position
Unknown
AA seq 612 aa
MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEESDLEKKRREA
EALLQSMGLTPESPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRRGPIKLGMAKITQV
DFPPREIVTYTKETQTPVMAQPKEDEEEEDDVVTPKPPVEPEEEKTLKKDEENDIKAPPH
ELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLS
LNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKTTPE
YVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYC
VNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNN
FVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTV
KLWTTKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASIS
VEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINANRA
DAEEEAATRIPA
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgtctgacaaaagtgaattaaaagctgagttggagcgtaagaagcagcggttggcccaa
atcagagaggaaaagaagagaaaagaagaagaaaggaaaaaaaaggaaactgatcagaag
aaggaagcagttgctcctgtgcaagaagaatcagatcttgaaaaaaaaagaagagaagct
gaagcattgcttcaaagcatggggctaactccagaatcccccattgtccctcctcctatg
tctccatcctccaaatctgtgagcacaccaagcgaagctggaagccaggactctggagat
ggtgccgtgggatctagacgaggacctattaaactcggaatggctaaaattacacaagtt
gactttcctcctcgagaaatcgtcacgtatacaaaggaaactcagactccagttatggct
cagcccaaagaagatgaagaggaagaagatgatgttgtgactcctaagcctcctgttgaa
cctgaagaagagaaaactttaaagaaagatgaagaaaatgatattaaagctccccctcat
gagctcactgaagaagaaaagcaacaaattttgcactctgaggaatttttaagtttcttt
gaccattctacaagaattgtagaaagagctctttctgaacagattaacatcttctttgac
tacagtgggagagatttggaagacaaagaaggagagattcaagcaggtgctaaactgtca
ctaaatcgacaattttttgacgaacgttggtcaaagcatcgtgttgttagttgtttggat
tggtcatctcagtacccagagttgcttgtggcttcctataacaacaatgaagatgctcct
catgagcctgatggtgtggccctcgtgtggaatatgaagtacaaaaaaactacgccagag
tatgtgtttcactgccagtcagctgtgatgtctgctacatttgcaaagtttcatccaaat
ctggttgttggtggtacatattcaggccaaattgtgctttgggataaccgtagcaataaa
agaactccagtgcaaagaactccgttgtcagctgctgcacacacacaccctgtatattgt
gtaaatgtagttggaacacaaaatgctcacaatctgattagcatctctactgatggaaaa
atttgttcatggagtttggacatgctttcccatccacaggatagcatggagttggttcat
aaacagtcaaaggcagtggctgtgacatctatgtccttccctgttggagatgtcaacaac
tttgttgttgggagtgaagagggctctgtgtacacagcatgccgccatggcagcaaagct
ggaatcagtgagatgtttgaggggcatcaaggaccaatcactggcatccattgtcatgca
gctgttggagcagtagacttctcacatctttttgtcacttcatcgtttgactggacagta
aaactttggacaactaagaataacaagcctttgtactcattcgaagataattcagactac
gtttatgatgttatgtggtcacccacccacccagccctatttgcctgtgtggatggcatg
gggagactggatttgtggaatctcaataatgacacagaggtgccaactgccagcatttcc
gtggagggtaatcctgctcttaatcgtgtaagatggacccattctggaagagagattgcc
gtgggtgattctgaaggacagattgttatatatgatgtgggcgagcagattgctgttccc
cgcaatgatgaatgggcacggtttggccgaactctcgcggaaatcaatgcaaaccgagct
gatgcagaggaggaagcagctactcggatacctgcttag

KEGG   Loxodonta africana (African savanna elephant): 100665421
Entry
100665421         CDS       T04351                                 

Gene name
DYNC1LI1
Definition
(RefSeq) cytoplasmic dynein 1 light intermediate chain 1
  KO
K10416  dynein light intermediate chain 1, cytosolic
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04962  Vasopressin-regulated water reabsorption
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100665421 (DYNC1LI1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100665421 (DYNC1LI1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100665421 (DYNC1LI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100665421 (DYNC1LI1)
   03036 Chromosome and associated proteins [BR:lav03036]
    100665421 (DYNC1LI1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100665421 (DYNC1LI1)
Membrane trafficking [BR:lav04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    100665421 (DYNC1LI1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      100665421 (DYNC1LI1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     100665421 (DYNC1LI1)
SSDB
Motif
Pfam: DLIC ABC_tran Roc RsgA_GTPase AAA_16 PduV-EutP G-alpha TsaE DUF815
Other DBs
NCBI-GeneID: 100665421
NCBI-ProteinID: XP_010593837
LinkDB
Position
Unknown
AA seq 555 aa
MGPQNRVGTRRGGPFPPGCRRRSWGPARGLTVQELCVGCRVLGSGRLTHPSAPCYSPGMR
PLFSTIVRCGAAADDEDGQNLWSCILSEVSTRSRSKLPAGKSVLLLGEDGAGKTSLIRKI
QGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVWILDGALYLKGLLQFSLEAISLKDTLVM
LVVDMSKPWTALDSLQKWASVVREHIDKLKIPPEEMKEMEQKLIRDFQEYVEPGEDFPPS
PQRRNTASQEDKDDSVVLPLGADTLTHNLGIPVLVVCTKCDAISILEKEHDYRDEHFDFI
QSHIRKFCLQYGAALIYTSVKENKNIDLVYKYIVQKLYGFPYKIPAVVVEKDAVFIPAGW
DNDKKIGILHENFQTLKPEDNFEDIITKPPVRKFVHEKEIVAEDDQVFLMKLQTLLSKQP
PTAAGRPVDASPRVPGGSPRTPNRSVSSNVASVSPIPAGSKKIDPNMKAGATSEGVLANF
FNSLLSKKSGSPGGPGGGSPGGGAAGGSSGLPSSSKKSGQKPVLSDVHAELDRIARKPVT
VSPPTATPPTEGEAS
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggggcctcagaaccgcgtcggtaccaggaggggcggcccatttccacctggatgccgg
cggcgtagctggggacctgctcgtggcctgacagtgcaggaactctgcgtcggctgccgg
gttttgggctccggccgcctgacacaccccagcgcgccctgctacagcccagggatgcgg
cccctgttttcaaccattgtccgctgcggcgcggccgcggacgacgaggacgggcagaac
ctctggtcctgcatcctcagcgaggtgtccactcggtcccgctccaagctccccgcgggg
aagagcgtgctgctgctgggtgaagatggagctggaaaaacaagcttaataagaaaaatt
cagggaatagaggagtacaagaaaggaagaggactggaatatttgtacttaaacgtgcac
gatgaagacagggacgatcaaacaagatgtaatgtatggatcttagacggggctctgtat
ctcaaaggcctccttcagttttcgctggaagccatttctctgaaggacacgctagtgatg
ctggttgttgatatgtcaaagccttggactgctttggattctttacagaaatgggcaagt
gttgttagagagcatattgacaaactgaaaattcctcctgaagaaatgaaagaaatggaa
caaaagctcattagagacttccaggaatatgtagagccaggagaagatttcccaccttcc
ccccagagaaggaacactgcgtcgcaggaagacaaggacgacagcgtggtcttacctctg
ggcgcggatacgcttacacataacttgggcatcccagtactggtggtttgcacaaagtgt
gatgccattagcatattggagaaagagcatgactacagagacgagcattttgattttatt
cagtcacatatccggaagttttgtttacagtatggtgcagcccttatttacacttcagta
aaagaaaacaaaaatatagatttagtgtataaatacatcgttcagaagctatatggattt
ccctataagattcctgctgttgttgtggaaaaagatgcagtatttattccagcagggtgg
gataatgacaagaaaataggaatattacatgaaaattttcaaacattaaaaccagaagat
aattttgaagacatcataactaaaccacctgtccgaaagtttgtgcatgagaaggagatt
gtagcagaagatgaccaggtgtttctcatgaagctgcagacccttttatcaaaacagcca
ccaactgcagctggaaggcctgtggatgcctcgccaagagtcccaggaggctcccctcga
acaccaaacagatccgtgtcgtccaacgttgctagcgtgtcacccattcctgctgggtca
aaaaaaattgatccaaacatgaaagctggagccacgagtgaaggtgtcctggcaaatttc
ttcaacagcttgctgagtaagaagagcggctccccaggaggccctggtggtgggagtcct
ggaggcggggctgcaggtggaagcagtgggctgccatcgtcctccaaaaagtcaggccag
aagcctgtcctatcagatgttcacgcagaactagacagaattgcacgaaaaccggttaca
gtttctcctccaacagctacaccccctacggaaggagaagcttcttga

KEGG   Loxodonta africana (African savanna elephant): 100670700
Entry
100670700         CDS       T04351                                 

Gene name
DYNC1H1
Definition
(RefSeq) cytoplasmic dynein 1 heavy chain 1
  KO
K10413  dynein heavy chain 1, cytosolic
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04962  Vasopressin-regulated water reabsorption
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100670700 (DYNC1H1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100670700 (DYNC1H1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100670700 (DYNC1H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100670700 (DYNC1H1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100670700 (DYNC1H1)
   04147 Exosome [BR:lav04147]
    100670700 (DYNC1H1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      100670700 (DYNC1H1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     100670700 (DYNC1H1)
Exosome [BR:lav04147]
 Exosomal proteins
  Proteins found in most exosomes
   100670700 (DYNC1H1)
SSDB
Motif
Pfam: DHC_N1 AAA_6 DHC_N2 AAA_9 AAA_8 Dynein_C AAA_7 AAA_lid_11 MT AAA_5 Dynein_heavy Dynein_AAA_lid AAA AAA_22 AAA_33 AAA_18 Mg_chelatase T2SSE AAA_19 AAA_lid_1 Phlebovirus_NSM AAA_25 POT1PC IstB_IS21
Other DBs
NCBI-GeneID: 100670700
NCBI-ProteinID: XP_023402321
LinkDB
Position
Unknown
AA seq 4469 aa
MAPSVEKKIAELEMGLLHLQQNIEIPEISLPIHPIITNVAKQCYERGEKPKVTDFGDKVE
DPTFLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEV
LLTLDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQAL
VAIFTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACF
EVFQTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLR
AVIVRVLRPQVTAVAQQNQGEVPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLD
VSKEGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHI
RGAIREYQTQLIQRVKDDIGSLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQ
LTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRI
FTIESTRVRGRSGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPF
AISLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGVALVWESYKLDPYVQRLA
ETVFNFQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLP
IWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKN
VVHELRITNQVIYLNPPIEECRYKLYQEMFAWKTVILSLPRIQSQRYQVGVHYELTEEEK
FYRNALTRMPDGPVALEESYSAVMGIVTEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLN
KWQALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGS
NMTEFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELYRNGQRLL
EKQRFQFPPSWLYIDNIEGEWGAFNDIMRRKDTAIQQQVANLQMKIVQEDRAVESRTTDL
LTDWEKTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELTDTGLLSGSEE
RVQVALEELQDLKGVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNLDGLLNQLKNFPARL
RQYASYEFVQRLLKGYMKINMLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDV
DLQKNEAIVKDVLLVAQGEMALEEFLKQIREVWNTYELDLVNYQNKCRLIRGWDDLFNKV
KEHINSVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADI
KHLLPVETQRFQSISMEFLALMKKVTKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGE
YLERERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILNDDNSVVLGIS
SREGEEVMFKTPVSITEHPKINEWLTLVEREMRVTLAKLLAESVTEVEIFGKATSIDPTT
YITWIDKYQAQLVVLSAQIAWSENVESALSTMGGGGDAAPLHSVLSNVEVTLNVLADSVL
MEQPPLRRRKLEHLITELVHQRDVTRSLIKSKIDNAKSFEWLSQMRFYFDPKQTDVLQQL
SIQMANAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVK
ALGHQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQVQC
IQEALREHSNPNYDKTSAPITCELLNKQVKVSPDMAIFITMNPGYAGRSNLPDNLKKLFR
SLAMTKPDRQLIAQVMLYSQGFRTAEVLANKIVPFFKLCDEQLSSQSHYDFGLRALKSVL
VSAGNVKRERIQKIKREKEERGEAVDEGEIAENLPEQEILIQSVCETMVPKLVAEDIPLL
FSLLSDVFPGVQYHRGEMTALREELRKVCQEMYLTYGDGEEVGGMWVEKVLQLYQITQIN
HGLMMVGPSGSGKSMAWRVLLKALERLEGVEGVAHIIDPKAISKDHLYGTLDPNTREWTD
GLFTHVLRKIIDNVRGELQKRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPP
NVRIMFEVQDLKYATLATVSRCGMVWFSEDVLSTDMIFNNFLARLRSIPLDEGEDEAQRR
RKGKEDEGEEAASPMLQIQRDAATIMQPYFTSNGLVTKALEHAFKLEHIMDLTRLRCLGS
LFSMLHQACRNVAQYNANHPDFPMQIEQLERYIQRYLVYAILWSLSGDSRLKMRAELGEY
IRRITTVPLPTAPNVPIIDYEVSISGEWSPWQSKVPQIEVETHKVAAPDVVVPTLDTVRH
EALLYTWLAEHKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDH
YCEYRRTPNGVVLAPVQLGKWLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRTSD
QTWVKLERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQIYGTFNRAMLR
LIPSLRTYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMTRWVRGIFEALRPLETLP
VEGLIRIWAHEALRLFQDRLVEDEERRWTDENIDMVALKHFPNIDKEKAMSRPILYSNWL
SKDYIPVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLIG
VSGAGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEKIAFIMDES
NVLDSGFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYKWFTSQ
VIRNLHVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLEK
PNYVVPDYMPVVYDKLPQPPSHREAIVNSCVFVHQTLHQANARLAKRGGRTMAITPRHYL
DFINHYANLFNEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNAAAN
DKLKKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEPAVIEAQNAVK
SIKKQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAE
EISDAIREKMKKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQ
KLEDDAKDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTA
LLKSLSAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQ
QANIQFRTDIARTEYLSNADERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQAT
EFIMNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVLNPVLNREVRRTG
GRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEVL
KAERPDVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKREA
AEVTRKVEETDVVMQEVETVSQQYLPLSTACSSIYFTMESLKQIHFLYQYSLQFFLDIYH
NVLYENANLKGVTDHTQRLSIITKDLFQVAFNRVARGMLHQDHITFAMLLARIKLKGTIG
EPTYDAEFQHFLRGNEIVLSAGSTPKIHGLTVEQAEAVVRLSCLPAFKDLIAKVQADEQF
GIWLDSSSPEQTVPYLWSEDSPATPIGQAIHRLLLIQAFRPDRLLAMAHMFVSTNLGESF
MSIMEQPLDLTHIVDTEVKPNTPVLMCSVPGYDASGHVEDLAAEQNTQITSIAIGSAEGF
NQADKAINTAVKSGRWVMLKNVHLAPGWLMQLEKKLHSLQPHACFRLFLTMEINPKVPVN
LLRAGRIFVFEPPPGVKANMLRTFSSIPVSRICKSPNERARLYFLLAWFHAIIQERLRYA
PLGWSKKYEFGESDLRSACDTVDTWLDDTAKGRQNISPDKIPWSALKTLMAQSIYGGRVD
NEFDQRLLNTFLERLFTTRSFDSEFKLACRVDGHKDIQMPDGIRREEFVQWVELLPDTQT
PSWLGLPNNAERVLLTTQGVDMISKMLKMQMLEDEDDLAYAETEKKTRADSTSDGRPAWM
RTLHTTASNWLHLIPQTLTHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQV
CEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERVKQLQSISLAAA
SGGAKELKNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVNVTTSQGAILDACS
FGVTGLKLQGATCSNNKLSLSNAISTILPLTQLRWVKQTNTEKKASVVTLPVYLNFTRAD
LIFTVDFEIATKEDPRSFYERGVAVLCTE
NT seq 13410 nt   +upstreamnt  +downstreamnt
atggctccctcggttgaaaaaaagatcgcagaacttgagatgggactccttcacctacag
caaaatattgagattccagagatcagcctacccatccatccaattatcacaaatgtggca
aaacagtgttacgaacgtggagaaaagccaaaagttacagactttggagataaggttgaa
gacccaacttttctcaatcagctacaatcgggagttaaccgctggatccgagaaattcag
aaggtgaccaaacttgatcgagatcctgcatcaggaaccgccttgcaggaaatcagtttt
tggctaaacttggagcgtgcactgtaccgcatccaggagaagcgggagagccccgaggtc
ctcctcaccctggatatcttgaaacacggcaagcgcttccatgccacagtcagctttgac
accgacacaggtctaaaacaggctttggaaactgtgaacgactacaaccctctgatgaag
gacttccctctgaatgacctgctgtctgccactgagctggacaagatcaggcaggcgctc
gtggcaattttcactcacttgcgaaagatccgaaacacaaaataccccattcagagggca
ctgcgcttggtggaggcaatttcaagagacttgagttctcagttactcaaagtgttggga
actagaaaattgatgcatgttgcttatgaagaatttgaaaaagttatggtagcatgcttt
gaagttttccagacttgggacgatgagtatgagaaactgcaggtgctgttgagagatata
gtgaaaagaaagcgggaggaaaacctgaagatggtgtggcgcatcaaccccgctcacagg
aagctgcaggcacgcctggaccagatgagaaagttcagacggcagcacgagcagctgagg
gctgtgattgtcagggtcctgaggccacaggtcacagcagttgcacaacagaatcaagga
gaggtacctgaaccccaagatatgaaagtagcggaggttctctttgatgctgccgatgca
aatgccattgaggaagtcaaccttgcttacgagaacgtcaaggaggtggatgggctcgac
gtctccaaagaaggcacggaagcctgggaggctgcgatgaagagatatgacgagaggatc
gacagagtggaaacccgcatcactgcccgcctccgtgaccaacttggcactgccaagaac
gcgaacgaaatgttcaggatcttctccaggttcaatgctctgtttgtcaggccccatatc
cgcggggccatccgtgagtaccaaacccagctgatccagcgtgtgaaagacgacatcggg
tctctgcacgacaagttcaaggtccagtatccacagagccaggcatgcaagatgagccac
gtgcgtgaccttccccccgtgtcagggtccatcatctgggccaagcagatagacaggcag
ctgaccgcctacatgaagcgtgtcgaagacgtccttggtaaaggctgggaaaaccacgtg
gaagggcagaagctgaaacaggacggggacagtttccgcatgaagctcaacactcaagag
atctttgatgactgggccagaaaggtgcagcagcgcaacctgggcgtttctgggcgcatt
ttcaccatcgaaagcacacgtgttcgaggccggtcaggaaatgtcctgaagctgaaggtg
aactttctccctgagatcatcacactctcaaaagaagtccgaaacctcaagtggctcggc
ttccgggtcccactggcgattgtgaacaaggcacatcaagcaaaccagctgtacccgttc
gccatctcgctgatcgagagcgtgcgcacttacgagcggacctgtgagaaggtggaggag
cgcaacaccatttcgctcctggtggccggcctgaagaaggaggtgcaggctctgatcgca
gagggcgtcgccctggtgtgggagtcctacaaactcgacccctacgtgcagcgcctagca
gagacggtcttcaacttccaagaaaaggtggatgacctgctgattattgaagagaaaata
gacctggaggtccgctccttggaaacatgtatgtatgatcacaagacgttctctgagatc
ttgaacagagtccagaaagcggtggacgacttaaatctgcactcctattccaacctgccc
atctgggtcaacaagctggacatggagattgaaagaatactgggtgtccgcctacaagct
ggcctgagagcttggacccaagtccttcttggacaagcggaagataaagcagaagttgac
atggatacggacgccccacaagtcagtcacaaacccggcggagagccaaagatcaaaaat
gttgtccatgagctgagaataaccaatcaggtcatctatttgaacccgcccattgaagag
tgcagatacaagctgtatcaggagatgtttgcgtggaagacggtcatcctgtctctcccc
aggatccagagtcagaggtaccaggtgggcgtccactatgaattgactgaagaagaaaaa
ttctaccggaacgctttgacgcggatgcctgacgggcctgtagccttggaggagtcgtat
tctgcggtgatgggtatcgtgactgaggtcgagcagtacgtcaaggtctggcttcagtat
cagtgtttatgggacatgcaagctgaaaacatctataacagactcggggaggatctgaac
aaatggcaggctctcttggtccagataaggaaggccagaggaacttttgacaacgcggaa
accaagaaggagtttggaccagtggttatagactatggcaaggtccagtccaaggtgaac
ttgaagtatgattcttggcataaggaggttctcagcaaattcggtcagatgctgggctcc
aacatgaccgaattccactcccagatctccaagtcccgccaagagctggagcagcactca
gtggacacggccagcacctccgacgcagtgaccttcatcacctacgtgcagtctctgaag
cggaagatcaagcagtttgagaagcaagttgagctctaccgcaacggtcagcgcctgctg
gaaaagcagcgcttccagttcccgccttcctggctctacatcgacaacatcgagggcgag
tggggggccttcaacgacatcatgcggcggaaggacacggccatccagcagcaggtggca
aacctgcagatgaagatcgtccaggaggaccgggccgtggagagccgcaccaccgacctg
ctgaccgactgggagaaaaccaagcctgtcaccggcaacctacggccagaggaggcactg
caggctcttactatctacgaagggaagtttggcaggctgaaggacgacagagagaagtgt
gccaaggccaaggaggcgctggagctgacagacacagggctgctcagtggcagcgaggag
cgtgtgcaggtggccttggaagaattacaggacctcaaaggcgtttggtcagaactttcc
aaggtctgggagcagattgaccagatgaaggagcagccgtgggtttcagtgcagccccga
aagctccggcaaaatttagacgggctcttgaaccagctgaaaaacttccctgcccggtta
cggcagtatgcatcctacgagtttgtccagaggcttctgaagggctacatgaagataaac
atgctagtgatcgaactgaagtccgaagcacttaaagaccgccactggaagcagctaatg
aagaggctgcatgttaattgggttgtttctgagctcacccttggccagatctgggacgtt
gacttgcagaaaaacgaagctattgtgaaggatgtgctgcttgtggcccaaggcgaaatg
gctctggaagaatttttgaaacagataagagaagtgtggaacacctacgagttagacctg
gttaactatcagaacaagtgtcgcttgatccgcggctgggatgacctcttcaacaaggtc
aaagagcacatcaacagtgtctcagccatgaagctctcaccgtattacaaggttttcgaa
gaggatgcccttagctgggaagacaagctgaatcggatcatggccctcttcgacgtgtgg
attgacgtgcagaggcggtgggtctacctggagggcatcttcacaggcagtgcagacatc
aagcacctgctgccggtggaaacccagagattccaaagcatcagcatggagtttctggct
ctgatgaaaaaagtcaccaagtccccccttgttatggatgttctgaacatccagggggtc
cagcggtctctggaaaggttggcagacctgctaggaaagatccagaaggcattgggagag
tacctggaacgggaacggtcgtctttccccaggttctattttgtgggcgatgaagatttg
cttgagatcattggaaacagcaagaatgtagctaaactacagaagcacttcaagaaaatg
tttgctggcgtttcgagcatcatcctgaatgacgataactctgtcgtcctaggcatttcc
tcccgagaaggagaggaggttatgtttaaaactcctgtgtcaattactgagcaccccaaa
atcaacgagtggctcacgctggtagaaagggagatgagagtcaccctggctaagcttctt
gccgagtctgtcacggaagttgagatttttggtaaagcaacttccattgaccccactacc
tacatcacatggatcgacaagtatcaggcccagcttgttgttctgtcagcgcagattgcc
tggtctgaaaatgtggaatctgctctaagcaccatgggcgggggcggtgacgcagctccc
ctacactccgtgctgagcaacgtggaggtcacgctcaacgtgcttgcagactccgtgctg
atggagcagcccccactccgcaggaggaagctggagcacctgattacagagctagtccac
cagagagatgttaccagatctttgatcaaaagcaagattgacaatgccaagtcctttgag
tggctcagccagatgcgattttactttgatcccaagcaaacagacgtgttacagcagtta
tccattcagatggcaaatgccaagttcaactatggctttgagtacctgggcgtacaggac
aagctggtccagacccccctcacagaccgctgctatttgaccatgacacaagccttggaa
gccaggcttggtgggtcaccctttggacctgctggtactgggaagacagagtctgtcaaa
gctcttggccatcagctcggacggtttgttttagttttcaactgcgacgaaaccttcgat
ttccaggcaatgggccggatctttgtggggctttgccaggtgggcgcgtggggctgcttc
gacgagttcaaccgcctggaggagcgcatgctctcggccgtgtcccagcaggtgcagtgc
atccaggaggcgctgcgcgagcactctaaccccaactacgacaagacctctgccccaatc
acatgtgagctgctgaacaaacaagtcaaggtgagcccggacatggctatcttcatcacc
atgaaccctggctacgcgggcaggtccaatctcccagacaacctgaagaagctgttccgg
agcctggccatgaccaagccggaccggcagttgatcgcccaggtcatgctgtactcccag
ggcttccgaaccgccgaggtgctcgccaacaagatcgtcccattcttcaaactgtgtgat
gagcagctctcttcccaaagccattatgactttggtctccgggctttgaagagtgtgttg
gtaagcgctggtaatgtgaagagggagagaattcagaagataaagagggagaaagaagaa
cgaggtgaagcagttgatgaaggagaaattgctgaaaatctacctgaacaggagatcctg
atacagagcgtctgtgagacgatggtgcccaagctggtggctgaggacatcccgctgctc
ttcagcctcttgtcggatgtgttccctggggtccagtaccaccgtggggagatgactgcc
ctccgagaagagctcaggaaagtgtgtcaggagatgtacttgacctacggcgatggcgag
gaggtcggcggaatgtgggtggaaaaggtcctccagctctatcagatcacccaaatcaat
cacggcctcatgatggtggggccctcgggcagcgggaagagcatggcctggcgcgtgctt
ctcaaggctctggagagacttgagggcgtggagggcgtggcccacatcatcgaccccaag
gccatcagcaaagaccacctctacggaaccctggaccccaacaccagggagtggaccgac
gggctgttcacacacgtcctgagaaagatcatcgataacgtgcggggcgagctgcagaag
cgccagtggatcatcttcgatggcgacgtggaccctgagtgggtggagaacctgaactca
gtgctggacgacaacaagctcctgactctgcccaatggggaacgcctcagcttgcccccc
aatgtacggataatgtttgaggtccaggacctgaagtacgccaccctggccaccgtgtca
cgctgtggcatggtctggttcagcgaggacgtgctgagtacagacatgatcttcaacaac
ttcctggccagactgcgcagcatccccctggacgagggggaggacgaggcgcagcgccgg
cgcaagggcaaagaggacgaaggggaggaggctgcatccccaatgctgcagattcagagg
gacgcggccaccatcatgcagccgtacttcacgtccaacggcctggtcaccaaggccttg
gagcacgcattcaagctggagcacatcatggacctgacgcggctccgctgcctgggttcg
ctcttctccatgctgcaccaggcctgccgcaacgtggcacagtataacgccaaccaccct
gacttccccatgcagatcgagcagctggagcgctacatccagcgctatctggtctacgcc
atactctggtccttgtccggagacagtcggctgaaaatgagagcagagctgggtgaatac
atccggagaatcacgaccgtgcccctgccgacggcacccaatgttcccatcattgactac
gaagtctccatcagcggcgagtggtcaccgtggcagtccaaggtgccacagatcgaggtg
gaaacgcacaaggtcgcagcccccgacgtggtcgtgccgaccctagacaccgtccgtcac
gaggccctcctgtacacgtggctggctgagcacaagcccctggtcctgtgtggccctccc
ggttctggcaagaccatgacgctctttagtgccctcagggccttgccggacatggaggtt
gtgggtctcaacttctcaagtgccaccaccccagagctccttctgaaaacgttcgatcac
tattgcgagtacaggcgcacgcccaatggggtcgtgctggctcccgtccagctcggcaag
tggctggtgttgttctgtgatgaaatcaacctcccagacatggataaatacgggacgcag
agggtcatatcattcatcagacagatggtggagcatgggggcttctaccgcacctctgac
cagacgtgggtgaagctggagcggatccagtttgtgggggcctgcaacccccccacggac
ccagggagaaagcccctgtcacacaggttcctacgccatgtgcccgtcgtgtacgtggac
tatccaggacctgcctcgctcacccagatctacggcaccttcaaccgtgccatgctgagg
ctcatcccgtccttgcgcacctatgctgagccgctgacagctgccatggtggagttctac
accatgtcgcaggaaaggttcactcaggacacacaaccccattacatctactcgccccga
gagatgacgaggtgggtgaggggcatctttgaagcactgaggcccctggagacactgccg
gtggaaggcctgattcggatttgggcccacgaagccctccgtctcttccaggacaggctg
gtcgaggacgaggagcggcgctggaccgacgagaacatcgacatggtggctctgaagcac
ttccctaacatcgacaaggagaaggctatgagccggcccatcctgtacagcaactggctg
tcaaaggattacatcccagtagaccaagaagagctaagagattatgtcaaagcaaggttg
aaagtcttctacgaggaagaacttgacgtcccgctggtcctgtttaatgaagtcttagac
catgtgctcaggattgaccgaatattccgtcaacctcaaggtcacttgcttctgattggt
gttagcggagcaggaaaaacgaccctgtcacgtttcgtcgcctggatgaatggtttgagt
gtgtatcagattaaggtccatcgaaaatacacgggagaagactttgatgaagatcttcgg
acggtgctgagacgttctggctgtaaaaatgaaaagatagcctttataatggatgaatcc
aacgtgttagattctgggttcttggagcggatgaatacccttctggccaacggagaggtg
cctggtctctttgaaggggacgaatatgccaccctgatgacccagtgtaaagagggggcg
caaaaggagggcttgatgctggactcgcatgaagagttgtataagtggttcaccagccag
gtcatccgcaacctccacgtcgtgttcaccatgaacccatcttccgagggcctcaaggac
cgggcagccacttcgccggcacttttcaacaggtgtgtgttgaactggtttggtgactgg
tccaccgaggcactctatcaagtcggcaaagagttcaccagtaaaatggacctggagaag
ccaaactacgtcgtacctgattacatgccagtcgtgtatgacaagctcccacagcccccg
tcccaccgggaagctattgtgaatagctgtgtgtttgttcaccagacgctgcaccaggct
aatgctcggctagcaaaacgcggcggcaggacgatggccatcacccctcgccactacttg
gacttcatcaaccactatgccaacctgttcaacgagaaaaggagtgagcttgaggaacag
cagatgcacctgaacgtcgggcttcggaaaatcaaggagacggtcgaccaggtagaagag
ctgcgccgtgacctgaggataaagagccaagagctagaagtgaagaatgccgcagctaac
gacaagctgaaaaagatggtgaaagatcagcaggaagcagaaaagaaaaaggtcatgagc
caggaaattcaggagcaactgcataagcagcaggaagtcattgcagacaaacagatgagc
gtgaaggaggaccttgacaaggtggagcctgccgtcatcgaggcccagaatgctgtgaag
tcaatcaagaagcagcacctggtagaggtacgctccatggcaaacccacccgctgcggtg
aagctggcactcgagtccatctgcctgctgctaggggagagcacaactgactggaagcag
atccgctccatcatcatgcgggagaacttcatccccactatcgtcaacttctctgcggag
gagatcagtgatgccatacgggagaaaatgaagaaaaactacatgtccaacccaagctac
aactatgagattgtcaaccgggcttccctggcctgcggccctatggtcaagtgggcaatc
gcacagctaaactatgcggacatgctgaagcgggtggagcccttgcggaacgagctgcag
aagctggaagatgacgccaaggacaaccagcagaaggccaacgaggtggagcagatgatc
cgtgacctggaggccagcattgcccgctacaaggaggagtacgctgtcctgatctcagag
gcccaggccatcaaggccgacctggctgccgtcgaagccaaagtaaaccggagcactgct
cttctcaagagtttgtctgctgaacgtgaacggtgggaaaaaacgagtgaaactttcaaa
aaccagatgtccaccattgctggggactgcctcctgtcagctgcatttatcgcttacgcg
gggtatttcgaccagcagatgcgccagaacttgttcacgacctggtcccatcacttacag
caagccaatatccagttccgcacagacatcgcgaggaccgagtacctctccaacgctgac
gaacggctccgctggcaggccagctccttacctgcggacgacctatgcacggaaaacgcc
atcatgctgaagcggttcaacaggtatccactcattatcgacccctctggacaggccaca
gaattcatcatgaacgagtacaaggaccggaagattacccgcaccagctttctggacgac
gccttcaggaagaacctggagagcgcgctgagatttggaaacccccttctggtccaggac
gtggagagctacgatccagttttaaatccagtcctgaaccgtgaagttcggcgaacagga
gggagagtgctgatcacgctcggcgaccaggacatagacctgtcgccctcgtttgtcatc
ttcctatccaccagagaccccactgttgagttcccaccagatctctgttcccgggttact
tttgtgaacttcaccgtcacccgaagcagcttacaaagccagtgtcttaacgaagtgctt
aaggcagaaaggcccgatgtggacgagaagcgttccgatctcctgaaacttcaaggggag
ttccagctgcgcttacggcagctggagaagtctctgctgcaagctctgaacgaggtgaag
ggccgcatcctggacgatgacaccatcataacgaccctggagaacctcaagcgagaggct
gccgaggtcacgaggaaggtggaggagacggatgtcgtcatgcaggaggtggagacggtg
tcgcagcagtacctgccgctctccacagcctgcagcagcatctacttcaccatggagtcc
ctgaagcagatacacttcctgtaccagtactccttgcagttcttcctggacatttaccac
aacgtcctgtacgagaatgccaacttgaagggcgtcacggatcacacgcagcggctctcc
atcataaccaaggaccttttccaggtggcgttcaaccgcgtggcccgcggcatgctgcac
caggaccacatcaccttcgccatgctgctggcgaggatcaagctgaagggcaccatcggg
gagcccacctatgacgccgagttccagcacttcctgagggggaatgagattgtcctgagc
gccggctcgactcccaaaatccacggcctgactgtcgagcaggccgaggcggttgtgagg
ctgagctgtctccctgcgtttaaagacctgatcgccaaggtgcaggctgacgagcaattt
ggcatctggctggacagcagctccccggagcagacggtgccatacctctggagcgaggac
tcgcctgcaactcccatcgggcaggccatccaccgcctactcctgatccaggccttccgc
cccgaccgtctcctggccatggcccacatgttcgtgtccacgaacctcggcgagtccttc
atgtccatcatggagcagccgcttgacctgacccacatcgtggacacggaggtaaagccg
aacacccccgtgctgatgtgctctgtgcctggttatgatgccagcgggcatgtggaggac
ctggcagctgagcagaacacacagatcacctccatcgccatcggctcggcggaaggcttt
aaccaggcagacaaggcaataaacacggccgtgaagtccggcaggtgggtgatgctgaag
aacgtgcacctggcgcccgggtggctgatgcagctggagaagaagctacactccctgcag
ccacacgcttgcttccggctgttcctcaccatggagattaaccccaaggtgcccgtgaac
ctgctccgtgccggacgcatcttcgtgttcgagcctccaccgggcgtgaaggccaacatg
ctaaggaccttcagcagcattcctgtctccagaatctgcaagtctcccaatgagcgtgcc
cgcttgtacttcctgctggcctggttccacgccatcatccaggaacgcctcagatacgcc
cccctggggtggtccaagaagtacgagttcggggagtcagacctgcggtcagcctgtgac
actgtggacacgtggctggacgacacggccaagggaaggcagaacatctctccagacaag
attccgtggtcagcgctcaagaccttgatggcccagtccatctacggcggacgtgtggac
aacgagtttgaccagcgcctgctcaacaccttcctggagcgtctgttcacgaccagaagc
ttcgacagcgagttcaagctggcctgcagggtggacgggcacaaggacatccagatgccc
gatggcatcaggcgagaggagtttgtgcagtgggtagagctgctccccgacacccagacg
ccctcctggctgggcctgcccaacaacgccgagagagtcctgctcaccacgcagggcgtg
gacatgatcagcaagatgctgaagatgcagatgctggaggacgaggatgacctggcatac
gcggagaccgagaagaagacgcgggctgactccacatcagatgggcgccccgcctggatg
aggacgctgcacaccaccgcctccaactggctgcatctgatcccccagacgctgacgcac
ctcaagcgaactgtggagaacatcaaggatcctttgttcaggttcttcgagagagaagtg
aagatgggagctaaattacttcaagatgttcgtcaggacctcgctgatgtcgtgcaagtg
tgtgaagggaagaagaagcagaccaactacctgcgcacactcataaatgagctggtgaaa
gggatcctgccgcggagctggtcccactacacggtgcccgctggcatgaccgtcatccag
tgggtgtctgacttcagtgagagagtcaaacagctgcagagcatctcactggcggcggca
tctggcggtgccaaggagctaaagaacatccacgtgtgcctgggcggcctgttcgtgccc
gaagcctacatcactgccaccagacagtatgtggcacaggccaacagctggtctctggag
gagctctgcctggaggtcaacgtcaccacctcgcagggcgccatactcgacgcctgcagc
ttcggggtcacgggcttgaagctccaaggggccacgtgcagcaacaacaagctgtcgctc
tccaacgccatctcaaccatcctcccgctcacacagctccgctgggtcaagcagacaaac
acagagaagaaggcgagcgtggtgaccttgcccgtctacctgaatttcacccgtgcggat
ctgatcttcaccgtagactttgaaatcgcgaccaaggaagacccgcgcagcttctacgaa
cgcggcgtcgccgtcttgtgcacagagtga

KEGG   Loxodonta africana (African savanna elephant): 100673565
Entry
100673565         CDS       T04351                                 

Gene name
DYNC1I1
Definition
(RefSeq) cytoplasmic dynein 1 intermediate chain 1 isoform X1
  KO
K10415  dynein intermediate chain, cytosolic
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04145  Phagosome
lav04962  Vasopressin-regulated water reabsorption
lav05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100673565 (DYNC1I1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100673565 (DYNC1I1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100673565 (DYNC1I1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100673565 (DYNC1I1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100673565 (DYNC1I1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      100673565 (DYNC1I1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     100673565 (DYNC1I1)
SSDB
Motif
Pfam: Dynein_IC2 WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 100673565
NCBI-ProteinID: XP_003407173
UniProt: G3TKT5
LinkDB
Position
Unknown
AA seq 675 aa
MIFAMVIQKGYSYIHFIYTHFSFFSSKEINMSDKSDLKAELERKKQRLAQIREEKKRKEE
ERKKKEADMQQKKEPAQDDSDLDRKRRETEALLQSIGISPEPPLVQPLHFLTWDTCYFHY
LVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGV
SKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVEPKVGHDSELENQDKKQEVKE
APPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRELEEKDGDVQAG
ANLSFNRQFYDEHWSKHRVVTCMDWSLQYPELMVASYNNNEDAPHEPDGVALVWNMKFKK
TTPEYIFHCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTH
PVYCVNVVGTQNAHNLITVSTDGKMCSWSLDMLSTPQESMELVYNKSKSVAVTGMAFPTG
DVNNFVVGSEEGTVYTACRHGSKAGIGEIFEGHQGPVTGINCHMAVGPIDFSHLFVTSSF
DWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLWNLNTDTEVPT
ASVAIEGASALNRVRWAQAGKEVAVGDSEGRIWIYDVGELAVPHTDEWTRFARTLMEIRA
NRADSEEEGTVELAA
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgatctttgcaatggtaatacagaaaggttattcatatatacattttatatacacacac
ttttctttcttttcctccaaggaaatcaacatgtctgacaaaagtgacttaaaagctgag
ctagagcgcaaaaaacagcgcttagcacagataagagaagagaagaagcggaaggaagag
gagagaaaaaagaaagaggctgatatgcagcagaagaaagagcctgcccaggacgactct
gatctggatcgcaaacgccgcgaaacggaggctctgctacaaagcattggtatatcaccg
gagccccctctagtgcagccgctgcatttcttaacatgggatacctgttattttcattat
ttagtcccaacccctatgtctccctcttcgaaatcagtgagcactcccagtgaagctgga
agtcaagactcaggcgatctggggccattaacaaggaccctgcagtgggacacagacccc
tcagtgctgcagctgcagtcagactcagaacttggacgaagactacataaacttggtgtg
tccaaggttactcaggtggatttcctgccaagggaagtagtgtcctactccaaggagacc
cagactcctctggctactcaccaatccgaagaggatgaggaagatgaagaaatggttgag
cctaaggttggccatgattcagaacttgaaaatcaagacaaaaaacaggaggtgaaagaa
gcccctccaagggagctgacagaagaagaaaaacagcagattcttcattcagaggaattc
ctcatcttttttgatcggacaataagggtaattgaacgagcattggcagaagactctgac
atcttttttgactacagtggtcgagagttagaggaaaaagatggggatgttcaggctgga
gccaacctttctttcaatcgtcagttctatgatgagcattggtccaagcatcgagtggtc
acctgtatggactggtctctccagtaccctgagctgatggtcgcttcctacaacaacaat
gaagatgctcctcatgaaccagatggagtggccttggtttggaatatgaagtttaagaaa
accacaccagagtacatcttccactgtcagtcctctgtgatgtcagtctgctttgcccgt
ttccatcccaacttggtggtcggtgggacttactcaggccagattgtcctgtgggataat
cgcagtcatcgaaggacaccagtgcagcggacacccttgtcggctgctgcacacacacat
cccgtgtactgtgtaaatgttgttgggacccagaatgctcataacctcatcactgtctct
accgatggtaaaatgtgttcctggagcctggacatgctgtcaactccacaggagagcatg
gagctggtgtacaataagtccaagtctgtggctgttactggaatggctttcccaacagga
gacgtcaataacttcgtggttggcagtgaggagggtacagtctacacggcttgtcgtcat
ggaagcaaagcaggcattggtgagatcttcgagggtcaccaaggaccagtgacggggatt
aactgccacatggcagtgggcccaattgatttttcacacctgtttgtcacgtcatcattc
gactggaccgtcaaactgtggaccacaaagcacaacaagccgctctactcctttgaagac
aacgcagactatgtgtacgacgtcatgtggtcccccgtgcatcccgcgctctttgcctgc
gtggacgggatggggcgcttggacctctggaacctcaacactgacaccgaggttccaaca
gcaagtgtggccattgagggggcatccgccctaaaccgtgttcgttgggctcaagctggc
aaagaagttgccgttggggactcagaaggccgcatctggatctacgacgttggagagctt
gcagttccccacaccgatgagtggacccgattcgccaggaccctcatggagattcgcgct
aacagagccgatagcgaggaggaaggcaccgttgagttagctgcctag

DBGET integrated database retrieval system