KEGG   Loxodonta africana (African savanna elephant): 100657081
Entry
100657081         CDS       T04351                                 

Gene name
HOMER2
Definition
(RefSeq) LOW QUALITY PROTEIN: homer protein homolog 2
  KO
K15010  homer
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100657081 (HOMER2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100657081 (HOMER2)
SSDB
Motif
Pfam: WH1 MAD CENP-F_leu_zip DUF812 Macoilin DUF3584 GAS Fez1 Jnk-SapK_ap_N Dor1 TMF_TATA_bd Crescentin DMPK_coil VGPC1_C Bap31_Bap29_C DUF4201 TACC_C Uso1_p115_C Seryl_tRNA_N PRKG1_interact FPP Leu_zip CALCOCO1 DUF5790 ATG16 SYCE1 DUF484 Laminin_II Phage_GP20 HIP1_clath_bdg YabA DHR10 UPF0242 NPV_P10 EzrA Sec8_exocyst
Other DBs
NCBI-GeneID: 100657081
NCBI-ProteinID: XP_023408606
LinkDB
Position
Unknown
AA seq 348 aa
WARLSCSREQPIFTTRAHVFQIDPSTKKNWVPASKQAVTVSYFYDVTRNSYRIISVDGAK
VIINSTITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKVACSFHSTQXCVKIIH
FDQESGCETPSSTQASSVNGTDDEKASHAGPADTQLKSENDKLKIALTQSAANVKKWEIE
LQTLRESNARLTTALQESAASVEQWKKQFSICRDENDRLRHKIDELEEQCSEINREKEKN
TQLKHRIEELESELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVR
SLKTDIEESKYRQRHLKVELKNFLEVLDGKIDDLHDFRRGLSKLGTDN
NT seq 1047 nt   +upstreamnt  +downstreamnt
tgggcgcgtctctcctgttccagagaacagcctatcttcaccacccgagcgcacgtcttc
cagattgaccccagcaccaagaagaactgggtgcctgcgagcaagcaggcggtcactgta
tcctacttctacgatgtcacgaggaacagctatcggatcatcagtgtggatggagccaag
gtgatcataaacagcacaatcactccgaatatgactttcaccaaaacgtcacagaagttt
gggcagtgggcagacagcagagccaacaccgtgtttggtttgggattttcctccgagcag
cagctgacaaaggtagcgtgctctttccatagtacacagtaatgtgtgaagataattcac
tttgaccaggaatctgggtgtgaaacaccatcttctactcaggcctccagtgtcaatggg
acggatgatgaaaaggcctcccacgcgggccctgctgacacacagctgaaatctgagaat
gacaagctgaagatcgccttgacacagagcgctgccaacgtgaagaaatgggagattgag
ctgcagaccctgcgggagagcaatgcccggctgaccacggcgctgcaggagtcagcggcc
agcgtggagcagtggaagaagcagttctctatctgccgtgacgagaacgaccggctccgc
cacaagatcgacgagctggaagagcagtgcagtgagataaacagagagaaggagaaaaat
acccagctgaagcataggattgaggagctggagtcagaactacgggagaaggagacggag
ttgaaagatctccgaaaacaaagtgaaatcatacctcagctcatgtcagagtgtgaatat
gtctccgagaaattagaggcagcagagagggacaatcagaacctggaagacaaagtgcgg
tctctaaagacggacattgaggagagtaaataccgacagcgccacctaaaggtagagttg
aagaacttcctggaggtgctggacgggaagatcgatgatctccatgacttccgcagaggc
ctctccaagctgggcacggacaactag

KEGG   Loxodonta africana (African savanna elephant): 100666467
Entry
100666467         CDS       T04351                                 

Gene name
HOMER3
Definition
(RefSeq) homer protein homolog 3
  KO
K15010  homer
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100666467 (HOMER3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100666467 (HOMER3)
SSDB
Motif
Pfam: WH1 Sec66 DUF4407 CENP-F_leu_zip Bap31_Bap29_C PKcGMP_CC
Other DBs
NCBI-GeneID: 100666467
NCBI-ProteinID: XP_010591513
LinkDB
Position
Unknown
AA seq 359 aa
MSTTREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELTSPALGLASHQMPPNSLVSANGPPSDEKLFRSQSADAPGPAERERLKKMLSEGS
VGEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRVEAERLRQRVAELEAQAA
AEQPTVGEKEPGQSLEQLEALVQTKDQEIQTLKSQTGGPRETPDAAEREETQQKVQDLET
RNAELERQLRVSEHSLEEARAERERARAEVVRATQLLDVKLFELSELREGLARLAEGTP
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtccacaaccagggagcagcccatcttcagcacacgagctcacgtattccagattgac
ccagccaccaagcggaactggatccccgcgggcaagcacgccctcaccgtctcctacttc
tacgatgccacccgcaatgtctaccgcatcatcagcatcgggggtgccaaggccatcatc
aacagcactgtcacccccaacatgaccttcacgaaaacttcccagaagttcgggcaatgg
gcagacagtcgtgccaatacagtctacggccttggctttgcatctgaacagcatctgacc
cagtttgccgagaagttccaggaagtgaaggaagcagcaaggcttgcccgggagaagtct
caggatgggggggagctcaccagcccagccctggggcttgcctcccaccagatgcccccg
aactccctcgtcagcgccaacggcccccccagcgacgaaaagctgttccgcagccagagc
gcggacgcccctggccccgcagagcgagagcggctcaagaagatgctgtctgagggctcg
gtgggcgaggtgcagtgggaggccgaattcttcgcgctgcaggacagcaacaataagctg
gcaggggccctgcgagaggcgaacgcggcggccgcgcagtggaggcagcagctggaggcc
cagcgcgtggaggcggagaggctgcggcagcgggtggctgagctggaggcccaggcagct
gcagagcagcccaccgtgggcgagaaggagcccgggcagtcactggagcagctggaggcg
ttagtgcaaaccaaggatcaggagatccagacactgaagagccagactggggggccccgg
gagacccccgacgctgctgagcgagaggagacgcagcagaaagtgcaggacctggagacg
cggaatgcagagctggagcgtcagctgcgggtgtcggagcacagcctggaggaggcgcgg
gcggagcgagagcgggcacgggctgaggtggtgcgggccacacagctgctggacgtcaaa
ctgtttgagctgagcgagctgcgtgagggcctggcccgcctggccgagggcacgccctga

KEGG   Loxodonta africana (African savanna elephant): 100672706
Entry
100672706         CDS       T04351                                 

Gene name
HOMER1
Definition
(RefSeq) homer protein homolog 1
  KO
K15010  homer
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100672706 (HOMER1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100672706 (HOMER1)
SSDB
Motif
Pfam: WH1 GAS HMMR_N BLOC1_2 DUF1664 FUSC ATG16 APG6_N EzrA FAP206 DUF1465 NPV_P10 Laminin_II
Other DBs
NCBI-GeneID: 100672706
NCBI-ProteinID: XP_010586540
LinkDB
Position
Unknown
AA seq 354 aa
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAIS
KHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQAN
AVHTHKTELNQTIQELEETLKVKEEEIEGLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
LEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggggaacaacctatcttcagcactcgagctcatgtcttccagattgacccaaataca
aagaagaactgggtacccaccagcaagcatgcagttactgtgtcttatttctatgacagc
acaagaaatgtgtataggataatcagtttagatggctcaaaggcaataataaatagcacc
atcaccccaaacatgacatttactaaaacatctcagaagtttggccaatgggccgatagc
cgggcaaacactgtttatggactgggattctcctctgagcatcatctttcaaaatttgca
gaaaagtttcaggaatttaaagaagctgctcgactagcaaaggagaaatcacaagaaaag
atggaacttaccagtacaccttcacaggaatcagcaggaggggatcttcagtctccttta
acaccagaaagtatcaatgggacagacgatgaaagaacacctgatgtgactcagaactca
gagccaagggctgaaccaactcagaatgcattgccattttcacatagttcagccatcagc
aaacattgggaggctgaactggctaccctcaaaggaaataatgccaaactcactgcagcc
ctgttggagtccactgccaatgtgaaacaatggaaacagcagcttgctgcgtatcaagag
gaagcagaacgtctgcacaagagagtgactgagcttgaatgcgttagtagccaagcaaac
gcagtgcatacccataagacagaattaaatcagacaatacaagaattggaagagacactg
aaagtgaaggaagaggaaatagaaggattaaaacaagaaattgataatgccagagaacta
caagaacaaagggactctttgactcagaaactacaggaagtagaaattcggaacaaagac
ctggagggacaactgtctgacttagagcaacgtctggagaaaagtcagaatgaacaagaa
gcttttcgcaataacctgaagacacttttagaaattcttgacggaaagatatttgaacta
acagaattacgagataacttggccaagctactagaatgcagctaa

DBGET integrated database retrieval system