KEGG   Loxodonta africana (African savanna elephant): 100657084Help
Entry
100657084         CDS       T04351                                 

Gene name
PCGF2
Definition
(RefSeq) polycomb group RING finger protein 2 isoform X3
  KO
K11460  polycomb group RING finger protein 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100657084 (PCGF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100657084 (PCGF2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     100657084 (PCGF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 zf-RING_UBOX zf-C3HC4_4 Prok-RING_4 zf-Nse zf-ANAPC11 Rad60-SLD zf-RING_10 FAP
Motif
Other DBs
NCBI-GeneID: 100657084
NCBI-ProteinID: XP_010592681
LinkDB All DBs
Position
Unknown
AA seq 345 aa AA seqDB search
MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQV
HKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQ
EKGALSDDEIVSLSIEFYEGVREREEKKGPLENGDGDKEKQTGVRFLRCPAAMTVMHLAK
FLRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLP
TAPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTS
PTPPSTASGASTAANGGTSNCLQTPSSTSRGRKMTVNGAPVPPLT
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgaaccacacggatcaaaatcacagagctgaaccctcacctcatgtgtgccctc
tgtggcgggtatttcatcgatgccactaccatcgtggagtgcttgcattccttctgcaaa
acctgcatcgtgcgctacctggagaccaacaaatactgccccatgtgtgacgtgcaggtc
cacaagacccgacctctgctgagcatcagatctgacaaaacccttcaagacattgtctac
aagttggtccctgggctttttaaagatgagatgaaacgacgacgggatttctatgcagct
taccccctgacagaggtccccaacggctccaacgaggaccgtggtgaggtcctggagcaa
gagaagggggccttgagtgatgatgagatcgtcagcctctccatcgagttctacgagggt
gtcagggagcgggaggaaaagaagggacccctggagaatggggatggggacaaggagaag
cagacaggggtgcgcttcctgcggtgcccagcagccatgacggtcatgcatcttgccaag
tttctccgcaacaagatggacgtccccagcaagtacaaggtggaggttctctatgaggac
gagccgctgaaggaatactataccctcatggatattgcctacatctacccttggcggcgg
aacggccccctccccctcaagtatcgtgtccagccagcctgcaagcggctcaccttgccc
acggcgcccaccccctcagagggcaccaacaccagtggggcttctgagtgtgagtcagtc
agcgacaaggctcccagccctgccaccctgccggccacctcctcctccctgcccagccca
gccaccccctcccatggctctcccagctcccacggccccccggccacccaccctacctcg
cccactccaccttcgacagccagtggggcctccacagcggccaatgggggcacctcgaac
tgcctgcagacaccatcttcaaccagcagggggcgcaagatgacggtcaatggagcgcct
gtgccccccttaacttga

DBGET integrated database retrieval system