KEGG   Loxodonta africana (African savanna elephant): 100657092
Entry
100657092         CDS       T04351                                 

Gene name
SLC9A3R1
Definition
(RefSeq) Na(+)/H(+) exchange regulatory cofactor NHE-RF1 isoform X1
  KO
K13365  sodium/hydrogen exchange regulatory cofactor NHE-RF1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04530  Tight junction
lav04928  Parathyroid hormone synthesis, secretion and action
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100657092 (SLC9A3R1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100657092 (SLC9A3R1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100657092 (SLC9A3R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100657092 (SLC9A3R1)
Transporters [BR:lav02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   100657092 (SLC9A3R1)
SSDB
Motif
Pfam: EBP50_C PDZ PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 100657092
NCBI-ProteinID: XP_010595277
LinkDB
Position
Unknown
AA seq 329 aa
MSSAAATGAPLPRLCCLEKGPNGYGFHLHGEKGKAGQFIRLVEPGSPAEKSGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPATDEQLQKLGVPVREELLRAQEGSGPA
EPPAATAAQRDGGESELREAEKSHAEQRELRPRLCAMKKGPNGYGFNLHSDKSKPGQFIR
AVDPDSPAEASGLRAQDRIVEVNGVCVEGKQHGDVVSAIKAGGDETKLLVVDRETDEFFK
KCKVIPSQEHLDGPLPELLINGEIQKLNYQDSPKKEDSTAPSSASSSSDPILDFNISLAV
AKERAHRKRGSKRAPQMDWNKKNELFSNL
NT seq 990 nt   +upstreamnt  +downstreamnt
atgagctcggccgcggcgaccggggcgcccctgccccggctctgctgcctggagaagggc
ccgaacggttatggcttccatctgcacggggagaagggcaaggcgggccagttcatccgg
ctggtggagcccggctcgcccgccgagaagtcggggctgctggccggggaccggctggtg
gaggtgaacggcgagaacgtggagaaagagacccaccaacaggtggtgagccgcatccgc
gccgcgctcaacgccgtgcgcctgctggtggtcgaccccgccacggacgagcagctacag
aagctgggcgtcccggtgcgcgaggagctgctgcgcgcccaggaggggtccgggccggcc
gagccgccggccgccaccgcggcgcagcgggatggcggcgagagcgagctgcgcgaggcc
gagaagagccacgcggagcagcgtgagctgcggccacggctctgtgccatgaagaagggc
cccaacggctacggcttcaatctgcacagtgacaagtctaagcctggccagttcatccgg
gcagtggacccagactctccagctgaggcctcagggctccgggcccaggaccgcatcgtg
gaggtgaacggggtctgcgtggaaggcaagcaacacggggatgtggtgtctgccatcaag
gccggtggggatgagaccaagctgctggtggtggacagggaaaccgatgagttcttcaag
aagtgcaaagtgatcccatcccaggagcacctggatggtcccttgcctgagctccttatc
aatggggagatacagaagttgaattaccaggacagccccaagaaagaagactccacagcg
ccctcctctgcctcctcctcctctgaccccatcctggacttcaacatctccctggctgtg
gccaaggagagggcgcacaggaaacgcggcagcaagcgggccccgcagatggactggaac
aagaaaaacgaactcttcagcaacctctaa

DBGET integrated database retrieval system