KEGG   Loxodonta africana (African savanna elephant): 100657108
Entry
100657108         CDS       T04351                                 

Gene name
GABBR1
Definition
(RefSeq) LOW QUALITY PROTEIN: gamma-aminobutyric acid type B receptor subunit 1
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04727  GABAergic synapse
lav04742  Taste transduction
lav04915  Estrogen signaling pathway
lav04929  GnRH secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100657108 (GABBR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100657108 (GABBR1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100657108 (GABBR1)
   04915 Estrogen signaling pathway
    100657108 (GABBR1)
  09156 Nervous system
   04727 GABAergic synapse
    100657108 (GABBR1)
  09157 Sensory system
   04742 Taste transduction
    100657108 (GABBR1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100657108 (GABBR1)
G protein-coupled receptors [BR:lav04030]
 Metabotropic glutamate receptor family
  GABA
   100657108 (GABBR1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 Peripla_BP_6 UPF0242 DUF3995 NEMP PKcGMP_CC COX1
Other DBs
NCBI-GeneID: 100657108
NCBI-ProteinID: XP_023396636
LinkDB
Position
Unknown
AA seq 784 aa
MSGGWPGARXCQPALEMALEDVNSRXDILPDYELKLIHHDSKCDPGQATKYLYELLYNDP
IKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTR
VKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQ
DARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKTYDPSINCTVDEMTE
AVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWAL
ALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWT
LIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSV
LSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRN
RFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYSTVGLL
VGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSKKMNTWLGIFYGYK
GLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFA
SLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRE
LEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPPDPSGGLPRGPSEPPDRLSCDGSRVH
LLYK
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgagcgggggctggcccggggccaggnnctgccagcccgcgttggagatggcgctggag
gacgtgaatagccgcnaggacatcctgccggactatgagctcaagctcatccaccacgac
agtaagtgtgacccaggccaagccaccaagtacctgtatgagctgctctacaatgaccct
atcaagatcatcctcatgcctggctgcagctccgtctccacgcttgtggctgaggctgcc
aggatgtggaacctcattgtgctttcctatggctcaagctcaccagccctgtcaaaccgg
cagcgttttcccacattctttcgtactcatccatcagccacactccacaacccgactcgt
gtgaaactctttgaaaaatggggctggaagaagattgccaccatccagcagaccactgag
gtcttcacttcgactctggatgacctagaggagcgagtgaaggaagctggaattgagatt
actttccgtcagagtttcttctcagacccagctgtgcctgtcaaaaaccttaagcgtcag
gatgcccgaatcatcgtgggacttttctatgagactgaagctcggaaagttttttgtgag
gtgtacaaggaacgtctctttgggaagaagtatgtctggttcctcattgggtggtatgct
gacaattggttcaagacctatgacccgtccatcaactgcacagtggacgagatgaccgag
gcagtagagggccacatcaccactgagattgtcatgctgaaccctgccaatacccggagc
atttccaacatgacatcccaggagtttgtggagaaactgactaaacgactaaaaagacac
ccagaggagacaggaggcttccaggaggcaccactggcttacgatgccatctgggccttg
gcgttggccctgaataagacatctggaggtggcggccgctcaggtgtacgcttggaggac
ttcaactacaacaaccagaccattaccgaccaaatctatcgggcaatgaactcctcatcc
tttgagggtgtctctggccatgtggtgtttgatgccagtggctctcggatggcatggaca
cttattgaacagctacagggtggcagctacaagaagattggctactatgacagcaccaag
gatgatctttcatggtccaaaacagataagtggattggcggttcccccccagcagaccag
accctggtcatcaagacattccgcttcctgtcacagaaactctttatctctgtctcggtt
ctctccagcctgggcattgtcctagctgttgtctgtctctcctttaacatctacaactcc
catgtccgttatatccagaactcacagcccaacctgaacaatctgactgctgtgggctgc
tcgctggcattagctgctgtcttccctcttggactggacggttatcacattgggagaaac
cgtttcccctttgtctgccaggcccggctctggctcctgggccttggcttcagtctgggc
tatggctccatgttcaccaagatctggtgggtccacacggtcttcacaaagaaggaggaa
aagaaggagtggaggaagaccctagaaccctggaagctgtactccacggtgggcctgctg
gtgggcatggacgtcctcactcttgccatctggcagattgtggatccgttacaccgaacc
atcgagacttttgccaaggaggagccgaaggaagacattgacgtttccattctgccccaa
ctggagcactgcagttccaagaagatgaacacttggcttggcattttctatggttacaag
gggctactgctgctactgggaatctttcttgcttatgagaccaagagtgtgtccactgag
aagatcaatgaccaccgggcggtgggcatggccatctacaatgtggcggtcctgtgcctc
atcactgcccctgtcaccatgattctctccagtcagcaggatgcagcgtttgccttcgcc
tctcttgccattgttttctcctcctatattactctggttgtgctctttgtgcccaagatg
cgcaggttgatcacccgaggggaatggcaatcagaggcgcaggacaccatgaagacaggg
tcatcgaccaacaacaatgaggaggagaagtcccggctcttggagaaggaaaaccgcgaa
ctggaaaagatcattgctgaaaaagaggagcgagtctctgaactgcgccatcagctccag
tctcggcagcagctccgctccaggcgccaccccccgacacccccagacccctctgggggc
cttcccaggggcccctctgagccccctgatcggcttagctgtgatgggagtcgggttcat
ttgctgtataaatga

KEGG   Loxodonta africana (African savanna elephant): 100657997
Entry
100657997         CDS       T04351                                 

Gene name
GABBR2
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 2
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04727  GABAergic synapse
lav04742  Taste transduction
lav04915  Estrogen signaling pathway
lav04929  GnRH secretion
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100657997 (GABBR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100657997 (GABBR2)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100657997 (GABBR2)
   04915 Estrogen signaling pathway
    100657997 (GABBR2)
  09156 Nervous system
   04727 GABAergic synapse
    100657997 (GABBR2)
  09157 Sensory system
   04742 Taste transduction
    100657997 (GABBR2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100657997 (GABBR2)
G protein-coupled receptors [BR:lav04030]
 Metabotropic glutamate receptor family
  GABA
   100657997 (GABBR2)
SSDB
Motif
Pfam: 7tm_3 ANF_receptor GBR2_CC Peripla_BP_6 Cation_ATPase_C GAPT GWT1 DUF812 APG6_N HOOK
Other DBs
NCBI-GeneID: 100657997
NCBI-ProteinID: XP_023400874
LinkDB
Position
Unknown
AA seq 881 aa
MEPHHGRSETQKVSHEERFVCVNPLLGFCPWRKLFLIWASLSVVAPQCDNAKGLKAFYDA
IKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDN
AVNPAILKLLKYFQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSV
KKLKGNDVRIILGQFDQYMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWDQVHTEANSS
RCHRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYD
GIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG
ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLP
LYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLD
GSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVI
VGGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIV
YAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQ
FCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSV
NQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILH
HAYLPSIGGVDASCVSPCVSPTGSPRHRHVPPSFRVMVSGL
NT seq 2646 nt   +upstreamnt  +downstreamnt
atggagccccaccatgggagaagtgaaacccagaaggtttcccatgaggaaagatttgtt
tgtgtaaatccactgctgggcttttgcccctggagaaagctgtttctaatttgggcttct
ctttctgttgttgctccacagtgtgataatgcaaaagggctgaaagccttctacgatgca
ataaaatatgggccaaaccacttgatggtgtttggaggcgtctgtccttccgtcacgtcc
atcatcgcagagtccctccaaggctggaatctggtgcagctttcctttgctgcgaccaca
cctgtcctagctgataagaaaaaatacccttacttctttcggactgtcccatcagataac
gcagtgaacccagccatcctgaagttactgaagtacttccagtggaagcgcgtgggcacg
ctgacacaggacgtgcagaggttctccgaggtgaggaacgacctgactggggttctgtac
ggtgaggacatcgagatttcggacacggagagcttctccaacgatccctgcaccagtgtc
aaaaagcttaaggggaatgacgtgcggatcattcttggccagtttgaccagtatatggca
gcaaaagtattctgttgtgcatatgaggagaacatgtacggtagcaaataccagtggatc
atcccaggctggtacgagccttcctggtgggaccaggtgcacacagaagccaattcatcc
cgctgccaccgtaagaacctgcttgctgccatggagggctacatcggcgtggactttgag
cctctgagttccaagcagatcaagaccatctcaggaaagactccacagcagtatgagaga
gagtacaacaacaagcggtcgggcgtggggcccagcaagttccacgggtacgcctacgac
ggcatctgggtcatcgctaagacgctgcagagggccatggagacactgcacgccagcagc
cggcaccagcggatccaggacttcaactacacagaccacacactgggcagaatcatcctc
aatgccatgaatgagaccaacttctttggcgtcacgggtcaagttgtgttccggaatggt
gagcgaatgggaaccattaaatttactcaatttcaagacagcagggaagtgaaggtggga
gagtacaacgctgtggctgacacgctggagatcatcaacgacaccatcaggttccaagga
tccgaaccgccaaaagacaagaccatcatactggagcagctccgtaagatctccctacct
ctctacagcatcctctctgccctcaccattcttggcatgatcatggccagcgcttttctc
ttcttcaacatcaagaatcggaatcagaagttgataaaaatgtctagtccatatatgaac
aaccttattatccttggaggaatgctctcctatgcatctatatttctctttggccttgat
ggatcctttgtctctgaaaagacctttgaaacactttgcactgtcaggacctggattctt
accgtgggctataccactgccttcggggcgatgtttgcaaagacgtggagggttcacgcc
atcttcaaaaatgtgaaaatgaagaagaagatcatcaaggaccagaagctacttgtgatc
gtggggggcatgctgctgatcgacctgtgcatcctgatttgctggcaggcggtggacccc
ctgaggaggacggtggagaggtacagcatggagccggaccctgcaggccgagacatctcc
atccgccctctcctggaacactgtgagaacacccacatgaccatctggctcggaatcgtc
tatgcctacaaggggcttctcatgttgttcggttgtttcttagcttgggagacccgcaac
gtcagcatccccgcgctcaacgacagcaagtacatcgggatgagtgtctacaacgtgggc
atcatgtgcatcatcggggccgccgtctccttcctgacccgggaccagcccaacgtgcag
ttctgcatcgtggccctggtcatcattttctgcagcaccatcaccctctgcctggtgttt
gtgccaaagctcatcactctgagaacaaacccagatgcagcaactcagaacaggcgattc
cagttcactcagaatcagaagaaagaagattctaaaacgtccacgtcggtcaccagcgtg
aaccaagcaagcacatcccgactggagggcctgcaatcagaaaaccatcggctgcgaatg
aagatcacagagcttgataaagacttggaagaggtcaccatgcagctgcaggacactcca
gaaaagaccacatacattaaacagaaccactaccaagagctcaatgacatcctcaatctc
gggaacttcaccgagagcacagatggtggaaaggccattttaaaaaatcacctcgatcaa
aacccccagctccaatggaacacaacagagccctctcgaacatgcaaagatcctatagag
gatatcaactccccagaacacatccaacgccggctgtctctccagctccccatcctccac
cacgcctacctcccgtccatcggaggcgtggacgccagctgtgtcagcccctgtgtcagc
cccactggcagcccccgccacagacatgtgccaccctccttccgagtcatggtctcgggc
ctgtaa

DBGET integrated database retrieval system