KEGG   Loxodonta africana (African savanna elephant): 100657192Help
Entry
100657192         CDS       T04351                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00010  Glycolysis / Gluconeogenesis
lav00053  Ascorbate and aldarate metabolism
lav00071  Fatty acid degradation
lav00280  Valine, leucine and isoleucine degradation
lav00310  Lysine degradation
lav00330  Arginine and proline metabolism
lav00340  Histidine metabolism
lav00380  Tryptophan metabolism
lav00410  beta-Alanine metabolism
lav00561  Glycerolipid metabolism
lav00620  Pyruvate metabolism
lav01100  Metabolic pathways
Module
lav_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100657192 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    100657192 (ALDH2)
   00620 Pyruvate metabolism
    100657192 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100657192 (ALDH2)
   00561 Glycerolipid metabolism
    100657192 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100657192 (ALDH2)
   00310 Lysine degradation
    100657192 (ALDH2)
   00330 Arginine and proline metabolism
    100657192 (ALDH2)
   00340 Histidine metabolism
    100657192 (ALDH2)
   00380 Tryptophan metabolism
    100657192 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100657192 (ALDH2)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100657192 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100657192
NCBI-ProteinID: XP_003420359
LinkDB All DBs
Position
Unknown
AA seq 521 aa AA seqDB search
MLRSAALAAASLGPRLGRRLLSSAATQAVPAPNPQPEVFYNKIFIDNEWHDAVSKKTFPT
INPSTGEVICQVAEGDKDDVDRAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDR
TYLAALETLDNGKPYVIAYQVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVN
IVPGYGPTAGAAIASHKDVDKVAFTGSTEVGHLIQVAAGNSNLKRVTLELGGKSPNIIMS
DADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFLERSVTRAKARVVGNPFDSQT
EQGPQVDETQFKKILGYIQSGKQEGAKLLCGGGAAADRGFFIQPTVFGDVQDGMTIAKEE
IFGPVMQVLKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVF
GAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTVKIPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgctcagccgcgctggccgccgccagcctcgggccccgcctgggccgccgcctc
ctgtcctccgccgccacccaggccgtgccggcgcccaacccgcagcccgaggtcttctac
aacaagatcttcatagataatgaatggcacgatgccgtcagcaagaaaacgttccccacc
atcaacccatccactggagaggtcatctgtcaggtagctgaaggggacaaggatgacgtg
gatagggcagtgaaggctgcccaggccgcgttccagctgggctcaccctggcgccgtatg
gatgcatccgataggggccgcctgctgtaccgcctggccgatctgattgagcgagaccgg
acctacctggcggctttggagactttggacaatggcaagccctacgtcatcgcctaccag
gtggatttagacatggtcctcaaatgtctcaggtattatgcaggctgggctgataagtac
catgggaaaaccattcccattgatggggatttcttcagctacacccgccatgagcccgtg
ggggtgtgtggacagatcatcccgtggaacttcccgctcctgatgcaagcatggaaattg
ggcccagccttggcaaccggcaatgtggtcgtgatgaaggtagctgagcagactccactc
accgccctctatgtggccaacctgattaaggaggctggctttccccctggtgtggtcaac
attgttcctggatatggcccaacggctggtgctgccatcgcttcccacaaggatgtggac
aaggtggcattcactggctccactgaggttggccacctaatccaggtggctgcggggaac
agcaacctcaagagggtgaccctggagctggggggaaagagccccaacatcatcatgtca
gatgctgacatggactgggctgtggagcaggcccacttcgccctgttcttcaaccagggc
cagtgctgctgcgccggctcccgaacctttgtgcaggaggatgtgtacgctgagttcctg
gagcgcagcgtcacccgggcaaaggcacgcgtggttggcaacccctttgacagccagact
gagcaggggccccaggtggacgagactcagtttaagaagattcttggctatatccagtct
gggaagcaggagggggcaaagctgctgtgtggtggtggggccgctgctgaccgtggcttc
ttcatccagcccaccgtgtttggagatgtgcaagatggcatgaccattgcaaaggaggag
atctttggaccagtgatgcaggtcctgaagttcaagaccatagaggaggtcgttgggagg
gccaacaactccaagtacgggctggctgcagctgtcttcacaaaggacttggacaaggcc
aattatctgtcccaagccctccaggctggcaccgtgtggatcaactgctatgatgtgttt
ggggcccagtccccgttcggtggctacaagatgtctgggaatggccgggagctcggggag
tacggtctgcaggcatatactgaagtgaaaactgtcactgtcaaaattcctcagaagaac
tcataa

DBGET integrated database retrieval system