KEGG   Loxodonta africana (African savanna elephant): 100657363
Entry
100657363         CDS       T04351                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta isoform X3
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01523  Antifolate resistance
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04062  Chemokine signaling pathway
lav04064  NF-kappa B signaling pathway
lav04068  FoxO signaling pathway
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04668  TNF signaling pathway
lav04722  Neurotrophin signaling pathway
lav04910  Insulin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04930  Type II diabetes mellitus
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav05010  Alzheimer disease
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05206  MicroRNAs in cancer
lav05212  Pancreatic cancer
lav05215  Prostate cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100657363 (IKBKB)
   04014 Ras signaling pathway
    100657363 (IKBKB)
   04064 NF-kappa B signaling pathway
    100657363 (IKBKB)
   04668 TNF signaling pathway
    100657363 (IKBKB)
   04068 FoxO signaling pathway
    100657363 (IKBKB)
   04151 PI3K-Akt signaling pathway
    100657363 (IKBKB)
   04150 mTOR signaling pathway
    100657363 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100657363 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100657363 (IKBKB)
   04621 NOD-like receptor signaling pathway
    100657363 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    100657363 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    100657363 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    100657363 (IKBKB)
   04660 T cell receptor signaling pathway
    100657363 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    100657363 (IKBKB)
   04659 Th17 cell differentiation
    100657363 (IKBKB)
   04657 IL-17 signaling pathway
    100657363 (IKBKB)
   04662 B cell receptor signaling pathway
    100657363 (IKBKB)
   04062 Chemokine signaling pathway
    100657363 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100657363 (IKBKB)
   04920 Adipocytokine signaling pathway
    100657363 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100657363 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100657363 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100657363 (IKBKB)
   05206 MicroRNAs in cancer
    100657363 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100657363 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100657363 (IKBKB)
   05221 Acute myeloid leukemia
    100657363 (IKBKB)
   05220 Chronic myeloid leukemia
    100657363 (IKBKB)
   05215 Prostate cancer
    100657363 (IKBKB)
   05222 Small cell lung cancer
    100657363 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100657363 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100657363 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100657363 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    100657363 (IKBKB)
   04931 Insulin resistance
    100657363 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100657363 (IKBKB)
   05135 Yersinia infection
    100657363 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100657363 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    100657363 (IKBKB)
   05161 Hepatitis B
    100657363 (IKBKB)
   05160 Hepatitis C
    100657363 (IKBKB)
   05171 Coronavirus disease - COVID-19
    100657363 (IKBKB)
   05164 Influenza A
    100657363 (IKBKB)
   05162 Measles
    100657363 (IKBKB)
   05168 Herpes simplex virus 1 infection
    100657363 (IKBKB)
   05163 Human cytomegalovirus infection
    100657363 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100657363 (IKBKB)
   05169 Epstein-Barr virus infection
    100657363 (IKBKB)
   05165 Human papillomavirus infection
    100657363 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100657363 (IKBKB)
   05142 Chagas disease
    100657363 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100657363 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100657363 (IKBKB)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100657363 (IKBKB)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100657363 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Glyco_hydro_65m
Other DBs
NCBI-GeneID: 100657363
NCBI-ProteinID: XP_003412554
LinkDB
Position
Unknown
AA seq 756 aa
MSWSPSLATQTCGPWEMKERLGTGAFGNVIRWHNQETGEQIAIKQCRQELSPRTRERWCL
EIQIMRRLNHPNVVTARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQRYTVTVDYWSFGTLAFECITGFRPFLPDWQPVQWHSKVRQKSE
MDIVVSEDLSGTVRFSSSLPYPNNLNSVLAQRLEKWLQLMLMWHPRQRGTDPLYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVTQDESLQSLKARIQADTGIPEEDQELLQEAGLA
LIPDRPATQCISDGKLNEGRSLDMDLVFLFDNSKVTYETQISPRPQPENVSCILQEPKRN
LSFPHLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQA
FEKKVRMIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSVNASRLSHPAQLMSQSATAPDSLAESVKKSEELVAEAHTLCSQLE
NVMQDTMKEQGQSFMALDWSWLKAEEAEQNSLEQAS
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctggcaactcagacatgtgggccctgggaaatgaaggaacga
cttgggacaggggcatttggaaacgtcatccgatggcacaatcaggaaacaggtgagcag
attgctatcaagcagtgccgacaggagctcagcccccggacccgagagcggtggtgcctg
gaaatccagatcatgagaaggctgaatcaccccaatgtagtgactgcccgggatgtccct
gagggaatgcagaacttggcccccaatgacttgcccctgctggccatggagtactgccaa
ggaggagatctccggaagtacctgaaccagtttgagaactgctgtggcctgcgggaagga
gccatcctcactttgctgagcgacattgcctctgcgcttagataccttcatgaaaacagg
atcatccatcgggacctaaagccagaaaacatcgtcctacagcaaggagagcagaggtta
atacacaaaattattgacctaggatatgccaaggagctggatcagggcagtctttgtact
tcctttgtggggaccctgcagtacctggccccagagctgctggaacagcagaggtacaca
gtgacggtggactactggagcttcggcaccctggcttttgagtgcatcaccggcttccgt
cctttcctccccgactggcagcctgtgcagtggcattcaaaagtccggcagaagagtgag
atggacatcgttgtgagtgaagacttgagtggaacagtgaggttttcaagctctttaccc
taccccaataatcttaacagtgtgctggcacagcgcctggagaagtggctgcagctgatg
ttaatgtggcacccccggcagaggggcacagatccgctgtacgggcccaacggctgtttc
aaggccctggacgacatcttaaacttgaagctggttcatatcttgaacatggtcacaggc
accattcatacctatccagtgacacaggatgaaagtctgcagagcttaaaggccagaatc
caggcagacacgggaatcccagaggaggaccaggagctgctgcaagaagcgggtctggcg
ttgatccccgacaggcctgccacgcagtgtatttcagatggcaagctaaatgagggccgc
tcgttggacatggatcttgtttttctctttgacaacagtaaagtcacctacgagacacag
atctcccctcggcctcaacctgaaaatgtcagctgtatccttcaagagcccaagaggaat
ctctctttcccccacctgaggaaggtgtggggccaggtctggcacagcatccaaaccctg
aaggaggactgtaaccggctgcagcagggacagcgagctgccatgatgaatctcctccgg
aataacagctgtctttccaagatgaagaattccatggcttccatgtctcagcagctcaag
gccaagttagatttctttaaaaccagcatccagattgacctggagaagtatagtgagcaa
actgagtttggaatcacttcagataaattgctgctggcttggagggaaatggaacaggcg
gtggagctctgcgggcgggaaaatgaagtgaaacatctcgtggaacggatgatggcactg
cagacagacatcgtggacttacagaggagcccgatgggtcggaagcagggagggacgctg
gatgacctagaagagcaagcaagggagctttacaggagactaagggaaaaaccgagagac
caacggactgatggtgacagtcaggaaatggtacggctgctgctccaggcaatccaggcc
tttgagaagaaagtgcgaatgatttatactcagctcagtaaaactgtagtttgcaagcag
aaggctctggaattgttgcccaaggtggaagaggtagtcagtttaatgaatgaggatgag
aagactgtggttcggcttcaggagaaacgacagaaggagctctggaatctcctgaagatc
gcttgtagcaaggtacgtggtcctgtcagtggaagcccagatagtgtgaatgcgtctcgt
cttagtcaccctgctcagctgatgtctcagtctgccactgcccctgacagcttagctgag
tcagtcaagaaaagtgaagaactggtggctgaagcgcacactctctgctcccagctagaa
aatgtgatgcaagacaccatgaaagaacaaggccagagttttatggctctggactggagc
tggttaaaagcggaggaagcagagcagaatagcctggagcaggcctcgtga

KEGG   Loxodonta africana (African savanna elephant): 100661492
Entry
100661492         CDS       T04351                                 

Gene name
IKBKG
Definition
(RefSeq) LOW QUALITY PROTEIN: NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01523  Antifolate resistance
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04062  Chemokine signaling pathway
lav04064  NF-kappa B signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04668  TNF signaling pathway
lav04920  Adipocytokine signaling pathway
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05212  Pancreatic cancer
lav05215  Prostate cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05340  Primary immunodeficiency
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100661492 (IKBKG)
   04014 Ras signaling pathway
    100661492 (IKBKG)
   04064 NF-kappa B signaling pathway
    100661492 (IKBKG)
   04668 TNF signaling pathway
    100661492 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100661492 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100661492 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100661492 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100661492 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100661492 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100661492 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100661492 (IKBKG)
   04660 T cell receptor signaling pathway
    100661492 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100661492 (IKBKG)
   04659 Th17 cell differentiation
    100661492 (IKBKG)
   04657 IL-17 signaling pathway
    100661492 (IKBKG)
   04662 B cell receptor signaling pathway
    100661492 (IKBKG)
   04062 Chemokine signaling pathway
    100661492 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100661492 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100661492 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100661492 (IKBKG)
   05203 Viral carcinogenesis
    100661492 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100661492 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100661492 (IKBKG)
   05221 Acute myeloid leukemia
    100661492 (IKBKG)
   05220 Chronic myeloid leukemia
    100661492 (IKBKG)
   05215 Prostate cancer
    100661492 (IKBKG)
   05222 Small cell lung cancer
    100661492 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100661492 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100661492 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100661492 (IKBKG)
   05135 Yersinia infection
    100661492 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100661492 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100661492 (IKBKG)
   05161 Hepatitis B
    100661492 (IKBKG)
   05160 Hepatitis C
    100661492 (IKBKG)
   05171 Coronavirus disease - COVID-19
    100661492 (IKBKG)
   05164 Influenza A
    100661492 (IKBKG)
   05162 Measles
    100661492 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100661492 (IKBKG)
   05163 Human cytomegalovirus infection
    100661492 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100661492 (IKBKG)
   05169 Epstein-Barr virus infection
    100661492 (IKBKG)
   05165 Human papillomavirus infection
    100661492 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100661492 (IKBKG)
   05142 Chagas disease
    100661492 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100661492 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100661492 (IKBKG)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100661492 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 ABC_membrane_2 LLC1
Other DBs
NCBI-GeneID: 100661492
NCBI-ProteinID: XP_023396514
LinkDB
Position
Unknown
AA seq 421 aa
MSKHPQKNPLCEMVQPSSGPAXDQDVLVEESSLGKSAMLHLPLEQGASEPLQRCLEENQE
LRDAFRESNQMLRERCEELLHFQVSQREEKEFLMQKFQEARKLVEKLSLEKLELKRQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAANKDLQALEGRARAASEQ
ARQLENEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQD
YDNHIKSSMASSERNRGIQLEDLKQQLQQAEEALVAKQELIDKLKEEAEQHKTVMETVPV
LRAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASSQESARALIEDMRK
RHVEGPQPPLPPAQAHHSFHLALPSQRRSPPEEPPDFCCPKCQYQAPDIDTLQIHVMECI
E
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgagcaagcatccccagaagaatccactttgtgagatggtgcagcccagtagtggtcca
gcgngggaccaggacgtgctggttgaagagtcttctctggggaagtcagccatgctccac
ctgcctttggagcagggtgcttccgagcccctccagcgctgtctggaggagaatcaggag
ctccgagatgcattccgggagagcaaccagatgctccgggagcgctgtgaggagctgctg
catttccaggtcagccagagagaggagaaggagttcctcatgcagaagttccaggaggcc
cggaaactggtagagaaactgagcctggagaagcttgagctgaagaggcagagagagcag
gccctgcaggaggtggagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tcggtgaaagcccaggtgacgtcactgctaggggagctccaggagagccagagccgctta
gaggctgccaacaaggacctgcaggctttggagggcagggcccgggcggccagcgagcag
gccaggcagctggagaacgagcgggaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagagccagagcgtggaggccgcactgcgcatggagcgtcaggccgcc
tcggaggagaagcggaagctggcccagttacaagtggcttatcaccagcttttccaagac
tatgacaatcacatcaagagcagcatggccagcagtgagcgaaaccgaggcatccagctg
gaagatttgaagcagcagctgcagcaggctgaggaggccctggtggccaagcaggagctg
atcgacaagctgaaggaggaggcggagcagcacaagacagtgatggagacggtccccgtg
ctcagggcccaggcggatatctacaaagcggactttcaggctgagaggcaggcccgggaa
aagctagccgagaagaaggagctgctgcaggagcagttggagcagctgcagagggagtac
agcaaactgaaggccagctcgcaggagtcagccagggctctgattgaggatatgcggaag
cggcatgtcgagggcccccagccacctttgcctcctgcccaagctcatcactcctttcac
ctggccctgcctagccagaggagaagcccccccgaggagccacctgatttctgttgtccc
aagtgccagtatcaggctccggatatcgacaccctgcagatacatgtcatggagtgcatt
gagtag

KEGG   Loxodonta africana (African savanna elephant): 100664361
Entry
100664361         CDS       T04351                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01523  Antifolate resistance
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04062  Chemokine signaling pathway
lav04064  NF-kappa B signaling pathway
lav04068  FoxO signaling pathway
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04380  Osteoclast differentiation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav04622  RIG-I-like receptor signaling pathway
lav04623  Cytosolic DNA-sensing pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04668  TNF signaling pathway
lav04920  Adipocytokine signaling pathway
lav05010  Alzheimer disease
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05200  Pathways in cancer
lav05212  Pancreatic cancer
lav05215  Prostate cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100664361 (CHUK)
   04014 Ras signaling pathway
    100664361 (CHUK)
   04064 NF-kappa B signaling pathway
    100664361 (CHUK)
   04668 TNF signaling pathway
    100664361 (CHUK)
   04068 FoxO signaling pathway
    100664361 (CHUK)
   04151 PI3K-Akt signaling pathway
    100664361 (CHUK)
   04150 mTOR signaling pathway
    100664361 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100664361 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100664361 (CHUK)
   04621 NOD-like receptor signaling pathway
    100664361 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    100664361 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    100664361 (CHUK)
   04625 C-type lectin receptor signaling pathway
    100664361 (CHUK)
   04660 T cell receptor signaling pathway
    100664361 (CHUK)
   04658 Th1 and Th2 cell differentiation
    100664361 (CHUK)
   04659 Th17 cell differentiation
    100664361 (CHUK)
   04657 IL-17 signaling pathway
    100664361 (CHUK)
   04662 B cell receptor signaling pathway
    100664361 (CHUK)
   04062 Chemokine signaling pathway
    100664361 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100664361 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100664361 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100664361 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100664361 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100664361 (CHUK)
   05221 Acute myeloid leukemia
    100664361 (CHUK)
   05220 Chronic myeloid leukemia
    100664361 (CHUK)
   05215 Prostate cancer
    100664361 (CHUK)
   05222 Small cell lung cancer
    100664361 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100664361 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100664361 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100664361 (CHUK)
   05135 Yersinia infection
    100664361 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100664361 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    100664361 (CHUK)
   05161 Hepatitis B
    100664361 (CHUK)
   05160 Hepatitis C
    100664361 (CHUK)
   05171 Coronavirus disease - COVID-19
    100664361 (CHUK)
   05164 Influenza A
    100664361 (CHUK)
   05162 Measles
    100664361 (CHUK)
   05168 Herpes simplex virus 1 infection
    100664361 (CHUK)
   05163 Human cytomegalovirus infection
    100664361 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100664361 (CHUK)
   05169 Epstein-Barr virus infection
    100664361 (CHUK)
   05165 Human papillomavirus infection
    100664361 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100664361 (CHUK)
   05142 Chagas disease
    100664361 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100664361 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100664361 (CHUK)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100664361 (CHUK)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100664361 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 100664361
NCBI-ProteinID: XP_003409226
LinkDB
Position
Unknown
AA seq 745 aa
MEGPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDHKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHDNVVKACDVPEELNVLVNDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKILHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNNLCSLIVESMENWLQLMLNWDPQQRGGPVDLVSKQPRC
FMLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHFYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQASAWLPPTSAEREHPLSCVVTPQDGETLAQMIEENLNCLGHL
STIIREANEEQGSSMMSLDWSWLKE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggaggggcccccgggcctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggcttcgggaacgtctgcctgtatcagcatcgggagcttgatcacaaa
atagcaattaagtcttgtcgcctagagctaagtactaaaaacagagaacggtggtgccac
gaaatccagatcatgaagaagttgaaccatgacaatgtggtaaaggcctgtgatgttcct
gaggaactgaatgtcttggttaatgatgtgcctcttctcgcgatggagtactgctctgga
ggagaccttcggaagctactcaacaagccagaaaattgctgtggacttaaagaaagccag
atactttctttacttagtgatataggatctgggattcgatatttgcatgaaaacaaaatt
atacatcgtgacctaaaacctgaaaacatagttcttcaggatgttggtgggaagatattg
cataaaataatcgatctaggatacgccaaagatgttgatcagggaagtctgtgtacatct
tttgtgggaacactgcagtatctggccccagagctttttgagaataagccttacacagcc
actgtggattactggagctttgggaccatggtgtttgaatgtattgctgggtataggcct
tttttgcatcatctgcagccattcacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgacaggagaagttcggttcagtagccatttacctcaa
ccaaataacctttgtagtttaatagtagaatccatggagaactggctacagttgatgctg
aattgggatcctcagcagagagggggacctgttgatcttgtttcaaagcagccaagatgt
ttcatgttaatggatcacattctgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttctttcttgttgccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactgggataaatactggttctcaggagcttctttcagagacaggaatt
tctctggaccctcgcaaaccagcctctcaatgtgtcctagatggagttagaggctgtgat
agctatatggtttacttgtttgataaaagtaagactgtatatgaagggccatttgcttcc
agaagtttatctgactgtgtaaattatattgtacaggacagcaaaatacagctacccatc
atacaactgcggaaagtatgggctgaagcagtgcattatgtatctgggctaaaagaagac
tacagcaggctctttcagggacaaagagcagcaatgttaagtcttcttagatacaatgct
aacttgacaaaaatgaagaacactttgatctcagcatctcagcagctgaaagctaaattg
gagttttttcacaaaagtattcagcttgacttggagagatacagtgagcagatgacatat
gggatatcctcagaaaaaatgttgaaagcatggaaagaaatggaagaaaaggccatccac
tatgctgaggttggcgttattggatacctggaggatcagatcatgtctctgcacactgag
atcatggagctacagaagagcccctacgggagacgtcagggagacttaatggaatctctg
gagcagcgtgccatcgatctatacaagcagttaaagcacaggccttcggatcacttctac
agcgacagcaccgagatggtgaagatcattgtgcatactgtgcagagtcaggaccgtgtt
ctcaaggagctgtttggtcatctaagcaagttactaggctgtaagcagaagattatcgat
ctgctccccaaggtggaagtagccctcagtaacatcaaagaagctgacaataccgtcatg
tttatgcagggaaagaggcagaaagaaatatggcatcttcttaaaattgcctgtacacag
agttctgcccgatccctcgtaggatccagtctagaaggtgcagtaactcctcaggcatca
gcatggctgcccccaacttcagcagaacgtgaacatcctctgtcatgcgtggtaactcct
caagatggggagactttagcacaaatgatagaagaaaatttgaattgtcttggccattta
agcactattattcgtgaagcaaatgaggaacagggcagtagtatgatgagtcttgactgg
agttggttaaaagagtga

DBGET integrated database retrieval system