KEGG   Loxodonta africana (African savanna elephant): 100657418
Entry
100657418         CDS       T04351                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04071  Sphingolipid signaling pathway
lav04270  Vascular smooth muscle contraction
lav04350  TGF-beta signaling pathway
lav04360  Axon guidance
lav04510  Focal adhesion
lav04530  Tight junction
lav04611  Platelet activation
lav04670  Leukocyte transendothelial migration
lav04810  Regulation of actin cytoskeleton
lav04921  Oxytocin signaling pathway
lav05135  Yersinia infection
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100657418 (ROCK1)
   04071 Sphingolipid signaling pathway
    100657418 (ROCK1)
   04024 cAMP signaling pathway
    100657418 (ROCK1)
   04022 cGMP-PKG signaling pathway
    100657418 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100657418 (ROCK1)
   04530 Tight junction
    100657418 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100657418 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100657418 (ROCK1)
   04670 Leukocyte transendothelial migration
    100657418 (ROCK1)
   04062 Chemokine signaling pathway
    100657418 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100657418 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100657418 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    100657418 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100657418 (ROCK1)
   05206 MicroRNAs in cancer
    100657418 (ROCK1)
   05205 Proteoglycans in cancer
    100657418 (ROCK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100657418 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100657418 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100657418 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100657418 (ROCK1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100657418 (ROCK1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100657418 (ROCK1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100657418 (ROCK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 Pkinase_C APH
Other DBs
NCBI-GeneID: 100657418
NCBI-ProteinID: XP_010585127
UniProt: G3TF10
LinkDB
Position
Unknown
AA seq 1354 aa
MSSGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSSRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNV
DKNLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGSQRRNLEST
VSQMEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
AQLQKQLEEANDLLRTESDTAARLRKSHTEMSKSISQLESLNIELQERNRILENSKTQTD
KDYYQLQAVLDAERRDRGHDSEMIGDLQARITSSQEEVKHLKHNLERLEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEEEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIQEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEMNSMLTRDIELLRKENE
ELTENMRKTEEEYKLKKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHKNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQEKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKEVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
NT seq 4065 nt   +upstreamnt  +downstreamnt
atgtcgtctggggacagttttgagactcggtttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcggattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgcattaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaattagagatttacgcatgaaagctgaagactatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaagacataaatccagcaggaag
gtatatgctatgaagcttcttagcaaatttgagatgatcaagagatctgattcagctttt
ttctgggaagaaagagacatcatggcttttgctaacagcccttgggttgttcagcttttc
tatgcattccaagatgatcgttatctctacatggtgatggaatacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgtgcctgaaaaatgggcgcggttttatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttattcatagagatgtgaag
cctgataatatgctgctggataagtctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggcatggtacgatgtgacacagcagttggaacacctgattat
atttcccctgaagtattaaaatcccaaggcggtgatggttattatggacgagaatgtgac
tggtggtcagttggggtatttttatatgaaatgcttgtaggtgatacacctttttatgca
gattctttggttgggacttacagtaagattatgaaccataaaaattcacttaccttccct
gatgataatgacatatcaaaagaagcaaaaaatcttatttgtgccttccttactgacaga
gaagtgagattagggcgaaatggtgtagaagaaatcaaacgacatctcttcttcaaaaat
gatcaatgggcttgggaaacacttcgagacactgtagcaccagttgtacctgatttaagt
agtgacattgatacaagtaattttgatgacttggaagaagacaagggagatgaagaaaca
ttccctattcctaaagcttttgttggcaatcagctaccttttgtaggatttacgtattat
agcaatcgtaggtacttatcttcagcaaatcctaatgataacagaactagttccaatgtg
gataaaaatttgcaggaaagtttgcagaaaacaatctacaagttggaagaacaactacat
aatgaaatgcaattaaaagatgaaatggagcagaagtgcagaacttcaaacataaaacta
gacaagataatgaaagaattggatgaagaggggagccaaagaaggaatctagaatctaca
gtgtcacagatggagaaggagaaaatgttgctacagcatagaattaatgagtaccaaaga
aaagctgaacaggaaaatgagaagagaaggaatgtagaaaatgaagtttctacgttaaag
gatcagttggaagacttaaagaaagtcagtcagaattcacagcttgctaatgagaaattg
gcacaattacaaaagcagctagaagaagccaatgacttacttaggacagagtcagacaca
gctgcaagattaaggaagagtcacacagagatgagcaagtcgattagtcagctagagtcc
ctgaacatagaattgcaggagagaaatagaattttagagaattccaagacacaaacggac
aaggattattaccagctgcaagctgtattagacgctgaacgaagagacagaggccatgat
tctgagatgattggagaccttcaagctcgaattacatcttcacaagaggaggtgaagcat
ctcaaacacaatcttgaaaggctggaaggagaaagaaaagaggctcaagacatgcttaat
cattcagaaaaggaaaagaataacttagagatagatttaaactacaagcttaaatcatta
caacaacggttagaacaagaagtaaatgaacataaagtaaccaaagctcgtttaactgac
aaacatcaatctattgaagaggcaaagtctgttgcaatgtgtgagatggaaaaaaagctg
aaggaagaaagagaagcccgagagaaggctgaaaatagggttgttcagattgagaaacaa
tgttccatgctcgatgttgatctaaagcaatctcagcagaagctagagcatttgactgaa
aataaagaaagaatggaggaagaagttaagaatctaaccctacaactggagcaggaatca
aataagcgactgctattacaaaatgaattgaagacacaagcttttgaggcagacaattta
aaaggtttagagaagcagatgaaacaggaaataaatacattattggaagcaaagagatta
ttagaatttgagttagctcagcttacaaaacaatatagaggaaacgaaggacagatgcgg
gagctacaagatcagcttgaagctgagcagtatttctcgacgctttataaaacccaggtg
aaggaacttaaggaagaaattcaagaaaaaaacagagaaaatttaaagaaaatacaggaa
ctacaaaatgaaaaagaaactcttgctactcaattggatctagcagaaacgaaagctgag
tctgagcagttagctcgagggcttttggaagaacagtattttgaattgacccaagaaagc
aagaaagctgcttcaagaaacagacaagagattacagataaagatcacactgttagtcgg
ctagaagaaatgaacagcatgctaacgagagatattgaattactaagaaaagaaaatgaa
gagctaactgaaaacatgaggaagacagaggaagaatataaattgaagaaggaagaggag
atcagtaatcttaaggctgcctttgaaaagaatatcaatacagaacgaaccctcaaaaca
caggctgttaacaagttggcagaaataatgaatcgaaaagattttaaaattgatagaaag
aaagctaatactcaagatttaagaaagaaggaaaaggaaaatcgaaaactacaactggaa
ctcaaccaagaaagagagaaattcaaccagatggtagtgaaacaccagaaggaactgaat
gacatgcaggcgcaattagtggaagaatgtacacataagaatgagcttcagatgcagttg
gctagcaaagagagtgatattgagcaactgcgtgctaaacttttggacctttcggattct
acaagtgttgctagttttcctagtgccgatgaaactgatggaaaccttccagagtcaaga
attgaaggttggctttcagtaccaaacagagggaatattaagcgatatggctggaagaaa
cagtatgttgtggtaagcagcaaaaaaattttgttctacaatgatgaacaagaaaaggaa
caatccaatccgtctatggtgttggacatagataaactgtttcatgttcgacctgtaacc
caaggggatgtgtatagagctgaaactgaagaaattcctaaaatattccagatattatat
gcaaacgaaggtgaatgtagaaaagaagtagagatggaaccagtacaacaagctgaaaaa
actaattttcaaaatcacaaaggccatgagttcattccgacactctaccacttcccagcc
aactgtgaggcctgtgccaaacctctctggcatgttttcaagccaccccctgccctagaa
tgtcgaagatgccatgttaagtgccacagagaccatttagataagaaagaggacttgatt
tctccctgtaaagtaagttatgatgtaacatcagcaagagatatgctgctgttagcatgt
tctcaggatgaacaaaagaaatgggtaactcatttagtaaagaagatccccaaaaatcca
ccctccggttttgttcgcgcatcccctcgaaccctttctacaagatctactgcaaaccag
tctttcaggaaagtggtcaaaaatacatctggaaaaactagttaa

KEGG   Loxodonta africana (African savanna elephant): 100658857
Entry
100658857         CDS       T04351                                 

Gene name
ROCK2
Definition
(RefSeq) rho-associated protein kinase 2 isoform X1
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04071  Sphingolipid signaling pathway
lav04270  Vascular smooth muscle contraction
lav04310  Wnt signaling pathway
lav04360  Axon guidance
lav04510  Focal adhesion
lav04530  Tight junction
lav04611  Platelet activation
lav04670  Leukocyte transendothelial migration
lav04810  Regulation of actin cytoskeleton
lav04921  Oxytocin signaling pathway
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05163  Human cytomegalovirus infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100658857 (ROCK2)
   04071 Sphingolipid signaling pathway
    100658857 (ROCK2)
   04024 cAMP signaling pathway
    100658857 (ROCK2)
   04022 cGMP-PKG signaling pathway
    100658857 (ROCK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100658857 (ROCK2)
   04530 Tight junction
    100658857 (ROCK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100658857 (ROCK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100658857 (ROCK2)
   04670 Leukocyte transendothelial migration
    100658857 (ROCK2)
   04062 Chemokine signaling pathway
    100658857 (ROCK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100658857 (ROCK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100658857 (ROCK2)
  09158 Development and regeneration
   04360 Axon guidance
    100658857 (ROCK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100658857 (ROCK2)
   05205 Proteoglycans in cancer
    100658857 (ROCK2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100658857 (ROCK2)
   05135 Yersinia infection
    100658857 (ROCK2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100658857 (ROCK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100658857 (ROCK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100658857 (ROCK2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100658857 (ROCK2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100658857 (ROCK2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100658857 (ROCK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 APH
Other DBs
NCBI-GeneID: 100658857
NCBI-ProteinID: XP_010590217
LinkDB
Position
Unknown
AA seq 1393 aa
MSRPLLTGKMPGAPEAVPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIKQHHFFKNDQWN
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
LLSDSPSCRENDSVQSRKNEVCINEESQEIQKKLYTLEEHLSNEIQAKEELEHKCKSVNT
RLEKITKELEEEVTLRKDVESSLRQLEREKALLQHKNAEYQRKADYEAEKKRNLENDVNS
LKDQLEELKKRNQNSQISTEKVNQLQKQLDETNALLRTESDTAARLRKTQAESSKQIQQL
ESNNRDLQDKNCMLETAKLKLEKEFINLQSALESERRDRTHGSEIISDLQGRISGLEEDL
KNGKILLAKVEMEKRQLQERFTDLEKEKSNMEIDMTYQLKVTQQTLEQEEAEHKATKARL
ADKNKIYESIEEATSEAMKEMEKTLLEERTLKQKVENLLLEAEKRCSIFDCDLKQSQQKI
NELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLM
EIKTSLEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVREFKEECEEKTKLCK
ELQQKKQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMA
RHKQELTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDAQDQLSRLKDEEISAAA
IKAQFEKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSERE
KLTQQMIKYQKELNEMQAQIAEESQFRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSI
GSGPGEAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSN
PYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNY
ICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPC
KVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSI
RRPSRQLAANKPS
NT seq 4182 nt   +upstreamnt  +downstreamnt
atgagccggcccctgctgacggggaaaatgcccggcgcccccgaggccgtgcccggggac
ggggctggcgcgagccgccagaggaagctggaggcgctgatccgagaccctcgctccccc
atcaacgtggagagcttgctggatggcttgaattccttggtccttgatttggattttcct
gctttgaggaaaaacaagaatatagataatttcttaaatagatatgagaaaattgtgaaa
aaaatcagaggcctgcagatgaaggcagaagactatgatgttgtaaaagtcattggaaga
ggtgcttttggtgaagtccagttggttcgtcataaggcatcacagaaagtttatgctatg
aagcttcttagtaagtttgaaatgataaaaagatcagattctgcatttttctgggaagaa
agagatattatggcctttgccaacagtccctgggtggttcagctcttttgtgcctttcaa
gatgataggtatctgtacatggtaatggagtacatgcctggtggagaccttgtaaacctt
atgagtaactatgatgtacctgaaaaatgggccaaattttatactgctgaagttgttctt
gctctggatgcaatacactccatgggtttaatacacagagatgtgaagcctgacaacatg
ctcttggataaacatggacatctaaaattagcagattttggcacgtgtatgaaaatggat
gaaacaggcatggtgcattgtgatacagcagtcggaacacctgattatatatcacctgag
gttctgaagtcacaagggggtgatggttactatggacgagaatgtgattggtggtctgta
ggtgttttcctttttgagatgctggtgggggatactccattttatgcagattcacttgtg
ggaacatatagcaaaattatggatcataaaaactcactgtgtttccctgaagatgcagaa
atttctaaacatgcgaagaatctcatctgtgccttcttaacagatagggaggtacgactt
gggagaaatggggtagaagaaatcaagcaacatcatttctttaagaatgatcaatggaat
tgggataacataagagaaactgcagctcctgtagtacctgaactcagcagtgacatagac
agcagcaattttgatgacatcgaagatgataaaggagatgtagaaacctttccaattcct
aaagcttttgtgggaaatcagctgccttttataggatttacctactatagagaaaatttg
ttgttaagtgattctccatcttgtagagaaaatgattcagtgcagtcaaggaaaaatgaa
gtatgtataaatgaagaaagtcaagagattcagaaaaaactctacacattagaagaacac
cttagcaatgaaattcaagccaaagaggaactagagcacaagtgcaaatctgttaatact
cgtctagagaaaataacaaaggagctagaagaagaggttaccttaaggaaagatgtggaa
tcatcattaagacaattagaaagagaaaaggcacttcttcagcacaaaaatgcagaatat
cagcggaaagctgactatgaagcagagaagaaacgaaatctggaaaatgatgttaacagc
ttaaaagatcaacttgaagaactgaaaaaaagaaatcaaaactctcaaatatccactgag
aaagtgaatcaactccagaaacaactggatgaaaccaatgctttgctgcgaacagaatct
gatactgcagctcggttaaggaaaacccaggccgaaagttcaaaacagattcagcagctc
gaatctaataatagagatctacaggataaaaactgcatgctggagactgccaaattaaaa
cttgaaaaggaatttatcaatcttcaatcagccctagaatctgaaaggagagaccgaacc
catggatcagagataattagtgatttacaaggtagaatatctggcctagaagaagactta
aagaatggcaaaatcttattagcaaaagtagagatggagaagagacaactacaagaaaga
ttcactgatttggaaaaggaaaagagcaacatggaaatagatatgacataccagctgaaa
gttacacagcagaccttagaacaagaagaagctgaacacaaggctacaaaagcccggcta
gcagataaaaataagatctatgaatccatcgaagaagctacatcagaagccatgaaagaa
atggagaagacgcttctagaggaaaggactttaaaacagaaagtggagaatctgttgctg
gaagctgagaaaagatgctctatattcgactgtgacctcaaacagtcacagcagaaaata
aatgagctccttaaacagaaagatgtgttaaatgaggatgttagaaacttgacattaaaa
atagagcaggaaacccagaagcgttgccttacgcaaaatgatttgaagatgcaaacacag
caagttaacacactaaaaatgtcagaaaagcagttaaaacaagagaataatcatctcatg
gaaataaaaacgagcttggaaaagcaaaatgctgaacttcgaaaagaacgtcaagatgca
gatgggcaaatgaaagagctccaagatcagcttgaagctgagcagtatttctcaacgctc
tataaaacacaggttagggaatttaaagaagaatgtgaagaaaagaccaaactttgtaaa
gaattacaacagaagaaacaagaattacaggatgaaagggactctttggctgcccagctg
gagatcaccttgaccaaagcagattctgagcagctggctcgttcaattgctgaagaacaa
tattccgatttggaaaaagagaaaatcatgaaagagctggagatcaaagagatgatggcc
agacacaaacaagagcttacagaaaaagatgctacaattgcatctcttgaagaaactaat
aggactctaaccagtgatgttgccaatcttgcgaatgagaaagaagaattaaacaacaaa
ctgaaagatgctcaagatcagctatcaaggttgaaagatgaagagataagtgcagcagct
attaaagcacagtttgagaaacagctgttaacagagagaacactcaaaactcaagctgtg
aataagttggctgagatcatgaatcgaaaagaacctgtcaagcgtggtaatgacacagat
gtacggagaaaagagaaggagaatagaaagctacatatggaacttaaatctgaacgtgaa
aaactgacccagcagatgatcaagtatcagaaagaactgaatgaaatgcaagctcaaata
gctgaagagagccagtttcggattgaactgcagatgacactggacagtaaagacagtgac
attgagcagctacggtcacagctccaggccctgcacattggtctagatagttccagtata
ggcagtggaccaggcgaagctgaggcagatgatggatttccagaatcaagattagaagga
tggctttcgttgcctgtgcgaaacaacactaagaaatttggatgggttaaaaagtatgtg
attgtaagcagtaagaagattcttttctatgacagtgaacaggataaagaacaatcgaat
ccttacatggttttagatatagacaagttatttcatgtccgaccagttacacagacagat
gtgtatagagcagatgcaaaagaaattccaaggatattccagattttgtatgccaatgaa
ggagaaagtaagaaggaacaagaatttccagtggagccagtgggagaaaaatcaaattat
atttgccataagggacatgaatttattcctactctttatcattttccaactaactgcgag
gcttgtatgaagccactgtggcatatgtttaaacctcctcctgctttagagtgccgtcgc
tgccatattaaatgtcataaagatcacatggacaaaaaggaggagattatagcgccttgc
aaagtgtattatgatatttcaacggcaaagaatctattgttgttagccaattccacagaa
gagcagcaaaagtgggttagtcggttggtgaaaaagatacctaaaaagcctccagcccca
gacccttttgcccggtcatctcctagaacttcaatgaagatacaacaaaaccaatctatt
agacggccaagtcgacagcttgctgcaaacaaaccaagctaa

DBGET integrated database retrieval system