KEGG   Loxodonta africana (African savanna elephant): 100657536
Entry
100657536         CDS       T04351                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04370  VEGF signaling pathway
lav04371  Apelin signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04668  TNF signaling pathway
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04920  Adipocytokine signaling pathway
lav04922  Glucagon signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04926  Relaxin signaling pathway
lav04929  GnRH secretion
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05017  Spinocerebellar ataxia
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100657536 (AKT3)
   04012 ErbB signaling pathway
    100657536 (AKT3)
   04014 Ras signaling pathway
    100657536 (AKT3)
   04015 Rap1 signaling pathway
    100657536 (AKT3)
   04370 VEGF signaling pathway
    100657536 (AKT3)
   04371 Apelin signaling pathway
    100657536 (AKT3)
   04630 JAK-STAT signaling pathway
    100657536 (AKT3)
   04668 TNF signaling pathway
    100657536 (AKT3)
   04066 HIF-1 signaling pathway
    100657536 (AKT3)
   04068 FoxO signaling pathway
    100657536 (AKT3)
   04072 Phospholipase D signaling pathway
    100657536 (AKT3)
   04071 Sphingolipid signaling pathway
    100657536 (AKT3)
   04024 cAMP signaling pathway
    100657536 (AKT3)
   04022 cGMP-PKG signaling pathway
    100657536 (AKT3)
   04151 PI3K-Akt signaling pathway
    100657536 (AKT3)
   04152 AMPK signaling pathway
    100657536 (AKT3)
   04150 mTOR signaling pathway
    100657536 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100657536 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    100657536 (AKT3)
   04218 Cellular senescence
    100657536 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100657536 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100657536 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100657536 (AKT3)
   04613 Neutrophil extracellular trap formation
    100657536 (AKT3)
   04620 Toll-like receptor signaling pathway
    100657536 (AKT3)
   04625 C-type lectin receptor signaling pathway
    100657536 (AKT3)
   04660 T cell receptor signaling pathway
    100657536 (AKT3)
   04662 B cell receptor signaling pathway
    100657536 (AKT3)
   04664 Fc epsilon RI signaling pathway
    100657536 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    100657536 (AKT3)
   04062 Chemokine signaling pathway
    100657536 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100657536 (AKT3)
   04922 Glucagon signaling pathway
    100657536 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    100657536 (AKT3)
   04920 Adipocytokine signaling pathway
    100657536 (AKT3)
   04929 GnRH secretion
    100657536 (AKT3)
   04915 Estrogen signaling pathway
    100657536 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    100657536 (AKT3)
   04917 Prolactin signaling pathway
    100657536 (AKT3)
   04926 Relaxin signaling pathway
    100657536 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    100657536 (AKT3)
   04919 Thyroid hormone signaling pathway
    100657536 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100657536 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100657536 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    100657536 (AKT3)
   04728 Dopaminergic synapse
    100657536 (AKT3)
   04722 Neurotrophin signaling pathway
    100657536 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100657536 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    100657536 (AKT3)
   04213 Longevity regulating pathway - multiple species
    100657536 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100657536 (AKT3)
   05205 Proteoglycans in cancer
    100657536 (AKT3)
   05230 Central carbon metabolism in cancer
    100657536 (AKT3)
   05231 Choline metabolism in cancer
    100657536 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100657536 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100657536 (AKT3)
   05212 Pancreatic cancer
    100657536 (AKT3)
   05225 Hepatocellular carcinoma
    100657536 (AKT3)
   05226 Gastric cancer
    100657536 (AKT3)
   05214 Glioma
    100657536 (AKT3)
   05221 Acute myeloid leukemia
    100657536 (AKT3)
   05220 Chronic myeloid leukemia
    100657536 (AKT3)
   05218 Melanoma
    100657536 (AKT3)
   05211 Renal cell carcinoma
    100657536 (AKT3)
   05215 Prostate cancer
    100657536 (AKT3)
   05213 Endometrial cancer
    100657536 (AKT3)
   05224 Breast cancer
    100657536 (AKT3)
   05222 Small cell lung cancer
    100657536 (AKT3)
   05223 Non-small cell lung cancer
    100657536 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100657536 (AKT3)
   05017 Spinocerebellar ataxia
    100657536 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100657536 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100657536 (AKT3)
   04931 Insulin resistance
    100657536 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100657536 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100657536 (AKT3)
   05135 Yersinia infection
    100657536 (AKT3)
   05152 Tuberculosis
    100657536 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100657536 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    100657536 (AKT3)
   05161 Hepatitis B
    100657536 (AKT3)
   05160 Hepatitis C
    100657536 (AKT3)
   05164 Influenza A
    100657536 (AKT3)
   05162 Measles
    100657536 (AKT3)
   05168 Herpes simplex virus 1 infection
    100657536 (AKT3)
   05163 Human cytomegalovirus infection
    100657536 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100657536 (AKT3)
   05169 Epstein-Barr virus infection
    100657536 (AKT3)
   05165 Human papillomavirus infection
    100657536 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100657536 (AKT3)
   05142 Chagas disease
    100657536 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100657536 (AKT3)
   01524 Platinum drug resistance
    100657536 (AKT3)
   01522 Endocrine resistance
    100657536 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100657536 (AKT3)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100657536 (AKT3)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100657536 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 100657536
NCBI-ProteinID: XP_010589354
UniProt: G3THW8
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcctctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacggaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
acggttatagagaggacatttcatgtagatactccagaggaaagggaagaatggaccgaa
gcgatccaggccgtagcagacagactgcagaggcaagaagaggagagaatgaattgtagc
ccaacttcacagattgataacattggggaggaagagatggatgcctctacaacacatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtgggaaatattatgctatgaagattctgaag
aaagaagttattattgcaaaggatgaagtggcccacactctaactgaaagcagagtatta
aagaatactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaattacagattttggactttgcaaggaagggatcacagatgca
gccaccatgaagacattctgtggtacaccagaatacctggcaccagaggtgttagaagat
aacgactatggtcgggcagtggactggtggggcctcggtgttgtcatgtatgaaatgatg
tgtgggaggctacccttctacaaccaggaccacgagaaactttttgaactaatactaatg
gaagacattaaatttcctcgaacgctctcttcagatgcaaaatcattgctttcagggctc
ttaataaaggatccaaataaacggcttggtggtggaccagatgatgcaaaagaaattatg
aggcacagtttcttttctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagacaccagatattttgatgaagaatttaca
gctcagacaattacaataacaccacctgaaaaatatgacgaggatggcatggactgcgtg
gacaatgagaggcggccacatttcccgcagttttcttactctgcaagtggacgagaataa

KEGG   Loxodonta africana (African savanna elephant): 100660187
Entry
100660187         CDS       T04351                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04370  VEGF signaling pathway
lav04371  Apelin signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04668  TNF signaling pathway
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04920  Adipocytokine signaling pathway
lav04922  Glucagon signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04926  Relaxin signaling pathway
lav04929  GnRH secretion
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05017  Spinocerebellar ataxia
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100660187 (AKT1)
   04012 ErbB signaling pathway
    100660187 (AKT1)
   04014 Ras signaling pathway
    100660187 (AKT1)
   04015 Rap1 signaling pathway
    100660187 (AKT1)
   04370 VEGF signaling pathway
    100660187 (AKT1)
   04371 Apelin signaling pathway
    100660187 (AKT1)
   04630 JAK-STAT signaling pathway
    100660187 (AKT1)
   04668 TNF signaling pathway
    100660187 (AKT1)
   04066 HIF-1 signaling pathway
    100660187 (AKT1)
   04068 FoxO signaling pathway
    100660187 (AKT1)
   04072 Phospholipase D signaling pathway
    100660187 (AKT1)
   04071 Sphingolipid signaling pathway
    100660187 (AKT1)
   04024 cAMP signaling pathway
    100660187 (AKT1)
   04022 cGMP-PKG signaling pathway
    100660187 (AKT1)
   04151 PI3K-Akt signaling pathway
    100660187 (AKT1)
   04152 AMPK signaling pathway
    100660187 (AKT1)
   04150 mTOR signaling pathway
    100660187 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100660187 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    100660187 (AKT1)
   04218 Cellular senescence
    100660187 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100660187 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100660187 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100660187 (AKT1)
   04613 Neutrophil extracellular trap formation
    100660187 (AKT1)
   04620 Toll-like receptor signaling pathway
    100660187 (AKT1)
   04625 C-type lectin receptor signaling pathway
    100660187 (AKT1)
   04660 T cell receptor signaling pathway
    100660187 (AKT1)
   04662 B cell receptor signaling pathway
    100660187 (AKT1)
   04664 Fc epsilon RI signaling pathway
    100660187 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    100660187 (AKT1)
   04062 Chemokine signaling pathway
    100660187 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100660187 (AKT1)
   04922 Glucagon signaling pathway
    100660187 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    100660187 (AKT1)
   04920 Adipocytokine signaling pathway
    100660187 (AKT1)
   04929 GnRH secretion
    100660187 (AKT1)
   04915 Estrogen signaling pathway
    100660187 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    100660187 (AKT1)
   04917 Prolactin signaling pathway
    100660187 (AKT1)
   04926 Relaxin signaling pathway
    100660187 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    100660187 (AKT1)
   04919 Thyroid hormone signaling pathway
    100660187 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100660187 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100660187 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    100660187 (AKT1)
   04728 Dopaminergic synapse
    100660187 (AKT1)
   04722 Neurotrophin signaling pathway
    100660187 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100660187 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    100660187 (AKT1)
   04213 Longevity regulating pathway - multiple species
    100660187 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100660187 (AKT1)
   05205 Proteoglycans in cancer
    100660187 (AKT1)
   05230 Central carbon metabolism in cancer
    100660187 (AKT1)
   05231 Choline metabolism in cancer
    100660187 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100660187 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100660187 (AKT1)
   05212 Pancreatic cancer
    100660187 (AKT1)
   05225 Hepatocellular carcinoma
    100660187 (AKT1)
   05226 Gastric cancer
    100660187 (AKT1)
   05214 Glioma
    100660187 (AKT1)
   05221 Acute myeloid leukemia
    100660187 (AKT1)
   05220 Chronic myeloid leukemia
    100660187 (AKT1)
   05218 Melanoma
    100660187 (AKT1)
   05211 Renal cell carcinoma
    100660187 (AKT1)
   05215 Prostate cancer
    100660187 (AKT1)
   05213 Endometrial cancer
    100660187 (AKT1)
   05224 Breast cancer
    100660187 (AKT1)
   05222 Small cell lung cancer
    100660187 (AKT1)
   05223 Non-small cell lung cancer
    100660187 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100660187 (AKT1)
   05017 Spinocerebellar ataxia
    100660187 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100660187 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100660187 (AKT1)
   04931 Insulin resistance
    100660187 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100660187 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100660187 (AKT1)
   05135 Yersinia infection
    100660187 (AKT1)
   05152 Tuberculosis
    100660187 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100660187 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    100660187 (AKT1)
   05161 Hepatitis B
    100660187 (AKT1)
   05160 Hepatitis C
    100660187 (AKT1)
   05164 Influenza A
    100660187 (AKT1)
   05162 Measles
    100660187 (AKT1)
   05168 Herpes simplex virus 1 infection
    100660187 (AKT1)
   05163 Human cytomegalovirus infection
    100660187 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100660187 (AKT1)
   05169 Epstein-Barr virus infection
    100660187 (AKT1)
   05165 Human papillomavirus infection
    100660187 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100660187 (AKT1)
   05142 Chagas disease
    100660187 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100660187 (AKT1)
   01524 Platinum drug resistance
    100660187 (AKT1)
   01522 Endocrine resistance
    100660187 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100660187 (AKT1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100660187 (AKT1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100660187 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like Seadorna_VP7 Pkinase_fungal
Other DBs
NCBI-GeneID: 100660187
NCBI-ProteinID: XP_023402429
LinkDB
Position
Unknown
AA seq 490 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEERSEGLGQRGWSPTCCRNPQLSSVSS
VAPFLWSPVPGGRLQRRPLLGPVQAGLPARVSEPTLLWSPPTLLLRLPCLEPEPSPRRLL
VSWGLCLASLSQDCWALHATWGLAHPPESAWASVLALFPFQALKYSFQTHDRLCFVMEYA
NGGELFFHLSRERVFSEERARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKI
TDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFY
NQDHEKLFELILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGAEDAKEIMQHRFFAS
IVWQDVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECADSERRPHFP
QFSYSASGTA
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccattgtgaaggaggggtggctgcacaagagaggtgagtacatcaag
acctggcggccacgctacttcttgctcaagaatgacggcaccttcattggctacaaagag
cggcctcaggacgtggaccagcgcgagtcccccctcaacaacttctctgtggcacaatgc
cagctgatgaagacggaacggcccaggcccaacaccttcatcattcgctgccttcagtgg
accacggtcatcgagcgcaccttccacgtagagacacccgaggagcggtctgaggggctg
ggccagcgtggctggtccccaacttgctgccgcaacccccagctgtctagcgtttcatcg
gtggctcctttcctctggagcccggttcctggtggtagactgcagaggcggcccctgctc
ggtcctgtccaagcagggctgccagccagggtctcagagcccaccctgctctggagcccc
cctaccctgctcctgaggctcccttgcctggagcctgaacccagcccccggcggctcctt
gtctcctggggcctctgtctcgcatccctgagccaagactgctgggctttgcatgccacg
tggggcctggcccacccccccgagtctgcctgggcctcggtcctagccctgttccccttc
caggccctgaagtactccttccagacccacgaccgcctctgcttcgtcatggagtacgcc
aacgggggcgagctcttcttccacctgtcccgggagcgcgtgttctccgaggagcgggcc
cgtttctatggcgctgagatcgtgtcggccctggactacctgcactcggagaagaacgtg
gtctacagagatctcaagctggagaacctcatgctggacaaggatggtcacatcaagatc
acagacttcgggctatgcaaggagggcatcaaggatggcgctaccatgaagaccttctgc
ggcacgcccgagtacctggcccctgaggtgctggaggacaacgactacgggcgggccgtg
gactggtgggggctgggcgtggttatgtacgagatgatgtgtggccgcctgcccttctac
aaccaggaccatgagaagctctttgagctcatcctcatggaagagatccggttcccacgc
acgctcagccctgaggccaagtcgctgctctccgggctgctcaagaaggaccccaagcag
aggctcggtgggggtgctgaggatgccaaggagatcatgcagcaccgcttcttcgccagc
atcgtgtggcaggatgtgtacgagaagaagctcagcccgcccttcaagccccaggtcacg
tcggagacggacacccggtattttgatgaggagttcacggcccagatgatcaccatcacg
ccacctgaccaagatgacaacatggagtgtgcggacagcgaacgcaggccccacttccct
cagttctcctactcggccagtggcacagcctga

KEGG   Loxodonta africana (African savanna elephant): 100663184
Entry
100663184         CDS       T04351                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav01524  Platinum drug resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04210  Apoptosis
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04218  Cellular senescence
lav04261  Adrenergic signaling in cardiomyocytes
lav04370  VEGF signaling pathway
lav04371  Apelin signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04611  Platelet activation
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04668  TNF signaling pathway
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04728  Dopaminergic synapse
lav04910  Insulin signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04920  Adipocytokine signaling pathway
lav04922  Glucagon signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04926  Relaxin signaling pathway
lav04929  GnRH secretion
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav04973  Carbohydrate digestion and absorption
lav05010  Alzheimer disease
lav05017  Spinocerebellar ataxia
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05142  Chagas disease
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05222  Small cell lung cancer
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100663184 (AKT2)
   04012 ErbB signaling pathway
    100663184 (AKT2)
   04014 Ras signaling pathway
    100663184 (AKT2)
   04015 Rap1 signaling pathway
    100663184 (AKT2)
   04370 VEGF signaling pathway
    100663184 (AKT2)
   04371 Apelin signaling pathway
    100663184 (AKT2)
   04630 JAK-STAT signaling pathway
    100663184 (AKT2)
   04668 TNF signaling pathway
    100663184 (AKT2)
   04066 HIF-1 signaling pathway
    100663184 (AKT2)
   04068 FoxO signaling pathway
    100663184 (AKT2)
   04072 Phospholipase D signaling pathway
    100663184 (AKT2)
   04071 Sphingolipid signaling pathway
    100663184 (AKT2)
   04024 cAMP signaling pathway
    100663184 (AKT2)
   04022 cGMP-PKG signaling pathway
    100663184 (AKT2)
   04151 PI3K-Akt signaling pathway
    100663184 (AKT2)
   04152 AMPK signaling pathway
    100663184 (AKT2)
   04150 mTOR signaling pathway
    100663184 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100663184 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    100663184 (AKT2)
   04218 Cellular senescence
    100663184 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100663184 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100663184 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100663184 (AKT2)
   04613 Neutrophil extracellular trap formation
    100663184 (AKT2)
   04620 Toll-like receptor signaling pathway
    100663184 (AKT2)
   04625 C-type lectin receptor signaling pathway
    100663184 (AKT2)
   04660 T cell receptor signaling pathway
    100663184 (AKT2)
   04662 B cell receptor signaling pathway
    100663184 (AKT2)
   04664 Fc epsilon RI signaling pathway
    100663184 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    100663184 (AKT2)
   04062 Chemokine signaling pathway
    100663184 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100663184 (AKT2)
   04922 Glucagon signaling pathway
    100663184 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    100663184 (AKT2)
   04920 Adipocytokine signaling pathway
    100663184 (AKT2)
   04929 GnRH secretion
    100663184 (AKT2)
   04915 Estrogen signaling pathway
    100663184 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    100663184 (AKT2)
   04917 Prolactin signaling pathway
    100663184 (AKT2)
   04926 Relaxin signaling pathway
    100663184 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    100663184 (AKT2)
   04919 Thyroid hormone signaling pathway
    100663184 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100663184 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100663184 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    100663184 (AKT2)
   04728 Dopaminergic synapse
    100663184 (AKT2)
   04722 Neurotrophin signaling pathway
    100663184 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100663184 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    100663184 (AKT2)
   04213 Longevity regulating pathway - multiple species
    100663184 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100663184 (AKT2)
   05205 Proteoglycans in cancer
    100663184 (AKT2)
   05230 Central carbon metabolism in cancer
    100663184 (AKT2)
   05231 Choline metabolism in cancer
    100663184 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100663184 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100663184 (AKT2)
   05212 Pancreatic cancer
    100663184 (AKT2)
   05225 Hepatocellular carcinoma
    100663184 (AKT2)
   05226 Gastric cancer
    100663184 (AKT2)
   05214 Glioma
    100663184 (AKT2)
   05221 Acute myeloid leukemia
    100663184 (AKT2)
   05220 Chronic myeloid leukemia
    100663184 (AKT2)
   05218 Melanoma
    100663184 (AKT2)
   05211 Renal cell carcinoma
    100663184 (AKT2)
   05215 Prostate cancer
    100663184 (AKT2)
   05213 Endometrial cancer
    100663184 (AKT2)
   05224 Breast cancer
    100663184 (AKT2)
   05222 Small cell lung cancer
    100663184 (AKT2)
   05223 Non-small cell lung cancer
    100663184 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100663184 (AKT2)
   05017 Spinocerebellar ataxia
    100663184 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100663184 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100663184 (AKT2)
   04931 Insulin resistance
    100663184 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100663184 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100663184 (AKT2)
   05135 Yersinia infection
    100663184 (AKT2)
   05152 Tuberculosis
    100663184 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100663184 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    100663184 (AKT2)
   05161 Hepatitis B
    100663184 (AKT2)
   05160 Hepatitis C
    100663184 (AKT2)
   05164 Influenza A
    100663184 (AKT2)
   05162 Measles
    100663184 (AKT2)
   05168 Herpes simplex virus 1 infection
    100663184 (AKT2)
   05163 Human cytomegalovirus infection
    100663184 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100663184 (AKT2)
   05169 Epstein-Barr virus infection
    100663184 (AKT2)
   05165 Human papillomavirus infection
    100663184 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100663184 (AKT2)
   05142 Chagas disease
    100663184 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100663184 (AKT2)
   01524 Platinum drug resistance
    100663184 (AKT2)
   01522 Endocrine resistance
    100663184 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100663184 (AKT2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100663184 (AKT2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100663184 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 100663184
NCBI-ProteinID: XP_003420826
UniProt: G3SRC6
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKRERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMQAIQMVANSLKQRGPGEDPM
DFKCGSPSDSSTAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQR
KLLPPFKPQVTSEIDTRYFDDEFTAQSITVTPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccagaagcgtggcgaatacatcaag
acctggaggcctcgctacttcctgctgaagagtgacggctccttcattggctacaaggag
aggcccgaggcccccgaccagaccctaccccccttaaacaacttctctgtcgcagaatgc
cagctgatgaagagggagaggccacggcccaacacttttgtcatacgctgcctacagtgg
accaccgtcattgagaggaccttccacgtcgactctccagatgagcgggaggagtggatg
caggccatccagatggtcgccaacagcctcaagcagcggggcccaggcgaggaccccatg
gacttcaagtgtggctcccccagcgactcttctacggctgaggagatggaagtggccgtc
agcaaggcgcgggccaaggtgaccatgaatgacttcgactatctcaaactccttggcaag
ggcacctttggcaaagtcatcctggtgcgggagaaggccagcggtcgctactacgccatg
aagatcctgcggaaggaggttatcatcgccaaggatgaagtcgcccacacagtcaccgag
agccgggtcctccagaacaccaggcacccattcctcactgcgctgaagtatgccttccag
acccatgaccgcctgtgctttgtgatggagtatgccaacggtggtgagctgtttttccac
ctgtcccgggagcgtgtcttcacagaggaccgcgcccggttttatggcgctgagatcgtc
tcggccctcgagtacttgcactctcgggacgtggtgtaccgcgacatcaagctggaaaat
ctcatgctggacaaagacggccacatcaagatcactgactttggcctgtgcaaagagggc
atcagtgatggggccaccatgaaaaccttctgtgggaccccggagtacctggcgcccgag
gtgctggaggacaatgactacggccgggccgtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgtggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagattcgcttcccgcgcacgctcagccccgaggccaagtccttg
cttgctgggctacttaagaaggacccaaagcagaggcttggcggggggcccagtgacgcc
aaggaggtgatggagcacaggttcttcctcagcatcaactggcaggatgtggtacagagg
aagctcctgccacccttcaaacctcaggtcacatctgagatcgacacaaggtacttcgac
gacgagttcacagcccagtccatcacagtcacacccccggaccgctatgacagcctgggc
tccctagaactggaccagcggacccacttcccccagttctcctactcagccagcatccgc
gagtga

DBGET integrated database retrieval system