KEGG   Loxodonta africana (African savanna elephant): 100657538
Entry
100657538         CDS       T04351                                 

Gene name
PATJ
Definition
(RefSeq) inaD-like protein isoform X1
  KO
K06092  InaD-like protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100657538 (PATJ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100657538 (PATJ)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100657538 (PATJ)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 L27_2 MPDZ_u10 UBA_3 DUF4597
Other DBs
NCBI-GeneID: 100657538
NCBI-ProteinID: XP_010589523
LinkDB
Position
Unknown
AA seq 1907 aa
MPENPAPDKIQVLQVLERLKMKLQEKGDTSQNEKLSTFYETLRSPLFNQILTLQQSIKQL
KGQLSHIPSDCTANFDFSRKGLLVFTDGSITNGNAHRPSNNLAVSGLFPWTPKLGNEDFN
SIIQQMAQGRQIEYIDIERPSAGGLGFSVVALRSQNLGEVDIFVKEVQPGSVADRDQRLK
ENDQILAINHTPLDQNISHQQAIALLQQTTGSLRLVVARDPARTRSSTSTSLSGTALPET
VGWGHVEDVELINDGSGLGFGIVGGKSSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTN
VQGMTSEQVAQVLRNCGNSVRMLVARDPIGEISVTPPTPTALPVALPAQANRSLGSDNST
LFETYDVELIKKDGQSLGIRIVGYVGNSHTGEASGIYVKSIIPGSAAYHNGQIQVNDKIV
AVDGVNIQGFDNQDVVEVLRNAGQVVHLTLVRRKTSLSDSLLEQPSDRGTVVEPPKTAAL
FLTGAVETETNVDDEDEEIEEIKDNEKNDNIHILEKLERVPDSPENELKFRWENLLGPDY
EVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVPGGPVATLNLLQ
PEDELLEVNGVQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRATEHSLLEQ
EVDHNIDVNTEEEDDGELALWSPEVQIVELVKDHKGLGFSILDYQDPLDSTKSVIVIRSL
VEDGVAERGGELLPGDRLVSVNEYCLDNARLAEAVEILKAVPPGTVRLGICKPLVEDDKQ
EESRCILHSSNNEDKPELSGTIHDTNSSLILEAPKEFRDEPYFKEELVDEPFPDLGKSFQ
SQQKEIDNSKETWEMHEIMSSRLQEMGEEREMLVDEEYELYQDRLQSMELYSSSQLQEAT
PASSMEEHHFGTQWSPDNEPPEPQEGRSMMSLYGQETQQYGYSTENMMKENFGIDSLPSI
TSTEGSSQRGRFNDLGNLNSLTESSLDSDMMMPNDAQGPSSLVDLPAVAHRRDQEELPSY
QLPETRFVSKASAYMGMLPPRLATNPCELPEREEGEGEETPNFSHWGPPRIVEIFREPNV
SLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTKALKTGDKILEVSGVDVQNAS
HTEAVEAIKNAGNPVVFVVQSLSLTPRVIPGVQNKTSKIISNQNQDNQEKKEKRQGTAPP
PVKLPPPYTVPSDESDENEEYAFTDKKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKD
RSRMSIFVVGINPEGPAATDGRMRIGDELLEINNQILYGRSHQNASAIIKTAPTKVKLVF
IRNEDAVNQMAVAPFPLPSSSPSSVEDQSGTEPVSSEEDGSLEVGIKQLPDSESSKMEDT
PQVVGQGIEEDQQKALDYSTDNTASQMKQQKYSTKVSFSSQEIPLSPTPLYHETDPTGYG
DCQDLLSVDPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLDAIVIHEVYEEGAAAR
DGRLWAGDQILEVNGVDLRSASHEDAITALRQTPQKVQLVVYRDEAHYRDEENLDTFPVD
LQKKAGRGLGLSIVGKRNGSGVFISDIVKGGAADLDGRLIQGDQILSVNGEDMRNASQET
VATVLKCAQGLIQLEIGRLRAGSWPSSRKTSQNSQGSQHSTSSTFPLSLTPVFSSLQNLV
GPKRTSNPSPQYPGTDMEPRTVEIIRALDDALGISIAGGKGSPLGDIPIFIAMIQASGVA
ARTQKLKVGDRIVSINGQPLDGLSHAEVVNLLKNTYGRIILQVVADTNISAIATQLESMS
TGYHLGSPTAEHHLEDTETPPPKIITLEKGSEGLGFSIVGGYGSPHGDLPIYVKTIFAKG
AAADDGRLKRGDQILAVNGETLEGVTHEQAVAILKRQRGTVTLTVLS
NT seq 5724 nt   +upstreamnt  +downstreamnt
atgccagaaaatcctgccccagataaaatccaggtcctgcaggttctcgagcgcctgaaa
atgaaattgcaggagaagggtgacacgtcacagaatgagaagctgtctacattttatgag
actctaaggagtcctctcttcaaccagatactcacacttcagcagtccatcaagcaactg
aaggggcaactcagtcatataccctcagattgtacagccaactttgatttttctagaaaa
gggttactggtgtttacagatggttccattactaatgggaatgcccacaggccctcgaat
aacttagctgtatctgggttatttccttggacccctaagctgggaaatgaagacttcaac
tcaattattcaacagatggctcagggccgacaaattgaatatatagatatagaacggcct
tcagctggaggccttggattcagtgtggtggcccttcgaagtcaaaatctgggagaagtt
gatatcttcgtgaaggaagtacagccagggagtgtagcagacagggatcaaaggttaaag
gaaaatgaccagatattggccattaatcacacgccactggatcagaacatttcccatcag
caagcaattgcattattacaacaaaccactggatctttgcgcctggttgtggccagagac
ccagcccgcacaagaagcagtacttccactagcctaagtggtacagctctgcctgaaaca
gttggttggggccatgttgaagatgttgagctcattaatgatggctctgggttaggtttt
ggaatagttggaggaaaatcaagtggcgtggttgtgaggactatagttcctggaggattg
gcagatcgagatggaagactccagacaggagaccacatcttgaagattggtggcacaaat
gtgcaaggaatgaccagtgagcaagttgctcaagtgctgaggaactgtgggaattcagtc
aggatgcttgttgctagagacccaattggtgaaatttcagtaacccctcccacccctaca
gccttacctgttgccctacctgctcaagccaacaggagccttggttctgacaattccact
ctttttgaaacttacgatgttgaactcattaaaaaggatggacagagtcttgggattaga
attgttggctatgttggaaactctcatacaggggaagcttcagggatttatgtgaaaagt
ataatacctggcagtgccgcataccacaatggccaaattcaagtgaacgacaaaatagtt
gctgttgatggtgtgaatattcaaggttttgacaaccaagatgttgttgaagtattaaga
aatgcagggcaggtggtgcacttaaccctagttcgaaggaagacatccttatctgattct
ctgcttgaacagccttcagacagagggactgttgtagaaccaccaaaaacagcagccctc
tttctaactggagcagtggaaacagaaactaatgtggatgatgaagatgaagaaattgaa
gaaataaaggataatgaaaaaaatgacaacatacacatcttagaaaaactggaaagagtc
ccagactcaccagaaaatgagctgaaattcagatgggaaaacctattgggccctgattat
gaagtaatggttgccactttggacacacagattgcggatgatgccgagttacagaaatac
tcaaagctgctacctattcatactctgaggctcggtgtggaagtggattcctttgatgga
caccattacatctcttcaattgttccaggtggccctgttgctacacttaatctcctacag
ccagaggatgagcttcttgaggtcaatggtgtacaactctatggaaaatctcgccgagaa
gctgtctcctttcttaaagaagtgccacccccttttaccttggtttgctgtcgacggttg
tttgatgacgaggcctctgtagatgaaccaagggccactgaacactctcttctcgagcag
gaggtagaccacaatatagatgtcaataccgaagaagaggatgatggggaattagcacta
tggtctcctgaagtccagattgttgaactagtgaaagatcataaaggcttgggattcagc
attttggattaccaggatcccttagattccacaaaatcagttattgtaattcgttctctg
gtggaggatggtgtggcagaaagaggtggagagcttttacctggagatcgcttagtctca
gtcaatgaatactgtttggacaacgcccggcttgctgaagctgtggaaatactgaaagcc
gtaccaccagggactgtccgccttggcatctgtaagcctttggtggaagatgataaacag
gaagaaagtagatgtattttacattcaagcaataatgaagacaagcctgaactttcagga
acaattcatgatacaaattcatctttaatacttgaagcacccaaggaatttagagatgaa
ccatattttaaagaagaactcgtggatgaaccatttccagatttgggaaagtctttccag
tcccaacagaaagagatcgacaacagcaaggagacttgggagatgcatgaaattatgtct
tctaggttgcaggaaatgggtgaagaaagagaaatgcttgttgatgaagaatatgagcta
tatcaagatcgtttgcagtccatggagttgtattcctcatctcagcttcaagaggccact
cctgcttcctccatggaggaacatcactttgggacgcagtggtcacctgataatgaacca
cctgagcctcaagaaggaagatctatgatgagtttatatggccaggagacacagcagtat
ggctatagcactgaaaacatgatgaaagaaaattttggcattgattccctaccctccata
acttcaactgaaggcagcagtcaacgaggcagatttaatgatctgggaaatcttaattca
ttaactgaaagcagtctggattcagacatgatgatgccaaatgatgctcaagggcctagc
tcgcttgttgaccttcctgccgtggctcacagaagggatcaagaagaattgccttcgtac
caactccccgagacccgatttgtttcaaaagcctcggcatacatgggaatgttgcctcct
agacttgccactaatccatgcgagttacctgagagagaagaaggtgaaggagaagaaact
cccaacttcagccactggggtccaccaagaattgttgagatttttagagaacccaatgtg
tctcttggaatcagtattgttggtggacaaaccgttataaaacgcctaaagaatggagag
gagcttaaaggtatatttatcaaacaagttttagaagacagtccagcaggaaaaacaaaa
gctcttaaaactggagataaaatacttgaggtgtctggagtagatgtgcagaatgcctca
cacacagaagcagtagaggccattaagaatgcaggaaaccccgtggtgtttgttgtccag
agcttgtcacttactccaagagtcattcctggtgtgcaaaataagaccagcaaaatcatc
agtaaccaaaaccaagacaaccaagaaaaaaaagaaaagaggcaaggaactgccccacct
ccagtgaaactgccccctccttatacggtgccgtctgatgagagtgatgaaaatgaagag
tatgcattcaccgacaaaaaaatcaggcaaagatatgcagacttgcctggagaactgcac
attatcgaacttgaaaaggataagaatggacttggactcagccttgctggtaataaagac
agatcacgcatgagcatatttgtggtgggaattaatcccgaaggacctgctgccacggat
ggaagaatgcgtattggagatgaactgttagagataaacaatcagatcctgtatggaaga
agtcaccaaaatgcatctgccattattaagactgccccaacgaaggtgaagttggttttc
attagaaatgaagatgcagtcaatcagatggctgttgctcccttcccattaccgtcaagt
tccccatcttctgttgaggatcagagtggcaccgaacctgttagtagcgaagaagatggc
agtctcgaagttggtattaaacaattgcctgacagtgaaagctccaaaatggaagacacc
ccccaggtggttggtcaaggcatagaggaagatcagcagaaggctttggactactcaact
gacaatactgccagccagatgaaacagcaaaaatattctacaaaagtctccttcagttca
caagagataccattatcaccaactccattataccacgaaacagaccctacaggctatggt
gattgccaggatcttctgtcagtggaccctgcaacgtgccccattgtccctggccaggaa
atgattatagaaatatccaagggacgctcgggccttggtctcagcatcgtgggaggaaaa
gacacacccctggatgctatagttatacatgaagtctatgaagaaggagcagcagccaga
gatggaagactttgggctggtgaccagatattagaggttaatggggttgacctgaggagc
gccagccatgaggatgccatcacggccctgaggcagaccccccagaaggtgcagctagtg
gtgtatagagacgaggcgcactacagggatgaggaaaacttggacacttttcctgtggat
ctgcagaagaaggccggccgaggactgggcctgagcatcgttgggaaacgaaatggaagt
ggagtgtttatttctgacatcgtgaaaggtggagctgcagaccttgatgggagattgatt
cagggagatcagatcttatctgtgaatggagaggacatgagaaatgcctcacaggagacc
gtggccactgtcctcaagtgtgctcaggggctcatacagctagagattgggagacttcga
gctggttcctggccctcctcaaggaagacatcacagaatagtcaggggagtcagcacagc
acttccagcacctttcctctttccctcacacctgtcttcagcagcctgcagaacctggtt
ggccccaaaagaacttccaacccttccccccaatatccaggcacagatatggaaccaagg
actgttgagataatcagagctctcgatgatgcccttggaattagtattgctggaggaaaa
ggaagtcctttaggagatatccctatatttattgccatgattcaggccagtggagtggca
gcacgcacacagaagcttaaagttggagatcggattgtcagcattaacgggcaacctttg
gatgggctgtctcacgcggaggtggttaatctgctaaagaacacctatggacgcattatc
ctgcaggttgtagcggataccaatataagtgccatagcaactcaacttgaaagcatgtct
acaggctaccatcttggttcacccactgctgaacaccatctggaagacacagaaacacct
ccacctaagattattactttggagaaaggctctgaaggattggggtttagtattgtaggg
ggttatggaagtccccatggagacctgccaatttatgtcaagactatatttgcaaaggga
gcagcagccgatgacggccgattgaagcggggtgatcagattttagctgttaatggcgag
actctggaaggtgttactcatgagcaagctgtggccattctaaaacgccagagagggact
gtgactttaactgtgctgtcatga

DBGET integrated database retrieval system