KEGG   Loxodonta africana (African savanna elephant): 100657587
Entry
100657587         CDS       T04351                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04218  Cellular senescence
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04371  Apelin signaling pathway
lav04540  Gap junction
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04730  Long-term depression
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04926  Relaxin signaling pathway
lav04929  GnRH secretion
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100657587 (MAP2K2)
   04012 ErbB signaling pathway
    100657587 (MAP2K2)
   04014 Ras signaling pathway
    100657587 (MAP2K2)
   04015 Rap1 signaling pathway
    100657587 (MAP2K2)
   04370 VEGF signaling pathway
    100657587 (MAP2K2)
   04371 Apelin signaling pathway
    100657587 (MAP2K2)
   04066 HIF-1 signaling pathway
    100657587 (MAP2K2)
   04068 FoxO signaling pathway
    100657587 (MAP2K2)
   04072 Phospholipase D signaling pathway
    100657587 (MAP2K2)
   04071 Sphingolipid signaling pathway
    100657587 (MAP2K2)
   04024 cAMP signaling pathway
    100657587 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    100657587 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    100657587 (MAP2K2)
   04150 mTOR signaling pathway
    100657587 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100657587 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    100657587 (MAP2K2)
   04218 Cellular senescence
    100657587 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100657587 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100657587 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100657587 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100657587 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    100657587 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    100657587 (MAP2K2)
   04660 T cell receptor signaling pathway
    100657587 (MAP2K2)
   04662 B cell receptor signaling pathway
    100657587 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    100657587 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100657587 (MAP2K2)
   04929 GnRH secretion
    100657587 (MAP2K2)
   04912 GnRH signaling pathway
    100657587 (MAP2K2)
   04915 Estrogen signaling pathway
    100657587 (MAP2K2)
   04917 Prolactin signaling pathway
    100657587 (MAP2K2)
   04921 Oxytocin signaling pathway
    100657587 (MAP2K2)
   04926 Relaxin signaling pathway
    100657587 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    100657587 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    100657587 (MAP2K2)
   04916 Melanogenesis
    100657587 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100657587 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    100657587 (MAP2K2)
   04730 Long-term depression
    100657587 (MAP2K2)
   04722 Neurotrophin signaling pathway
    100657587 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100657587 (MAP2K2)
   05206 MicroRNAs in cancer
    100657587 (MAP2K2)
   05205 Proteoglycans in cancer
    100657587 (MAP2K2)
   05230 Central carbon metabolism in cancer
    100657587 (MAP2K2)
   05231 Choline metabolism in cancer
    100657587 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100657587 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100657587 (MAP2K2)
   05225 Hepatocellular carcinoma
    100657587 (MAP2K2)
   05226 Gastric cancer
    100657587 (MAP2K2)
   05214 Glioma
    100657587 (MAP2K2)
   05216 Thyroid cancer
    100657587 (MAP2K2)
   05221 Acute myeloid leukemia
    100657587 (MAP2K2)
   05220 Chronic myeloid leukemia
    100657587 (MAP2K2)
   05218 Melanoma
    100657587 (MAP2K2)
   05211 Renal cell carcinoma
    100657587 (MAP2K2)
   05219 Bladder cancer
    100657587 (MAP2K2)
   05215 Prostate cancer
    100657587 (MAP2K2)
   05213 Endometrial cancer
    100657587 (MAP2K2)
   05224 Breast cancer
    100657587 (MAP2K2)
   05223 Non-small cell lung cancer
    100657587 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100657587 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    100657587 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100657587 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100657587 (MAP2K2)
   05135 Yersinia infection
    100657587 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100657587 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    100657587 (MAP2K2)
   05161 Hepatitis B
    100657587 (MAP2K2)
   05160 Hepatitis C
    100657587 (MAP2K2)
   05164 Influenza A
    100657587 (MAP2K2)
   05163 Human cytomegalovirus infection
    100657587 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100657587 (MAP2K2)
   05165 Human papillomavirus infection
    100657587 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100657587 (MAP2K2)
   01522 Endocrine resistance
    100657587 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100657587 (MAP2K2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100657587 (MAP2K2)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE7 family
   100657587 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 100657587
NCBI-ProteinID: XP_010599563
LinkDB
Position
Unknown
AA seq 303 aa
MARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQ
VLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSG
QLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELSVGRYPIPPPDAKELEA
IFGRPVVDGAEGEPHSVSPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGV
FTQDFQEFVNKCLIKNPAERADLKMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTR
TTV
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcgaggaagctgattcacctggagatcaagccggccatccggaaccagatcatccgg
gagctgcaggtcctgcacgagtgtaactccccgtacatcgtgggcttctacggggccttc
tacagcgacggggagatcagcatctgcatggagcacatggacggaggctccctggaccag
gtgctgaaagaagccaagaggattccagaagagatcctggggaaggtcagcattgcggtt
ctccggggcttggcgtacctccgggaaaagcaccagatcatgcaccgagatgtgaagccc
tccaacatcctggtcaactccagaggggagatcaagctgtgtgacttcggggtgagcggg
cagctcatcgactcgatggccaactcctttgtggggacacgctcctacatgtcgccggag
cgcttgcaaggcacccactactccgtgcagtcggacatctggagcatgggcttgtcgctg
gtggagctgtccgttgggaggtaccccatccccccgccggatgccaaggagctggaggcc
atcttcggccggccggtggtcgacggggccgagggagagccccacagcgtctcgccacgg
ccacggccccctggacgccccatcagtggtcacgggatggacagccggcccgccatggcc
atctttgaactgctggactacattgtgaatgagcctcccccgaagctgcccagcggcgtc
ttcacccaggacttccaggagtttgtaaataaatgcctgatcaagaacccggcagagcgt
gctgacctgaagatgctgatgaaccacaccttcatcaaacgctccgaggtggaagaagtg
gattttgcaggctggttgtgtaaaaccctgaggttgaaccagcccagcacgcccacgcga
accaccgtgtga

KEGG   Loxodonta africana (African savanna elephant): 100667623
Entry
100667623         CDS       T04351                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04114  Oocyte meiosis
lav04140  Autophagy - animal
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04210  Apoptosis
lav04218  Cellular senescence
lav04270  Vascular smooth muscle contraction
lav04370  VEGF signaling pathway
lav04371  Apelin signaling pathway
lav04380  Osteoclast differentiation
lav04510  Focal adhesion
lav04540  Gap junction
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04666  Fc gamma R-mediated phagocytosis
lav04668  TNF signaling pathway
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04730  Long-term depression
lav04810  Regulation of actin cytoskeleton
lav04910  Insulin signaling pathway
lav04912  GnRH signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav04915  Estrogen signaling pathway
lav04916  Melanogenesis
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04921  Oxytocin signaling pathway
lav04926  Relaxin signaling pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04929  GnRH secretion
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05034  Alcoholism
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05210  Colorectal cancer
lav05211  Renal cell carcinoma
lav05212  Pancreatic cancer
lav05213  Endometrial cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05216  Thyroid cancer
lav05218  Melanoma
lav05219  Bladder cancer
lav05220  Chronic myeloid leukemia
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
lav05230  Central carbon metabolism in cancer
lav05231  Choline metabolism in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100667623 (MAP2K1)
   04012 ErbB signaling pathway
    100667623 (MAP2K1)
   04014 Ras signaling pathway
    100667623 (MAP2K1)
   04015 Rap1 signaling pathway
    100667623 (MAP2K1)
   04370 VEGF signaling pathway
    100667623 (MAP2K1)
   04371 Apelin signaling pathway
    100667623 (MAP2K1)
   04668 TNF signaling pathway
    100667623 (MAP2K1)
   04066 HIF-1 signaling pathway
    100667623 (MAP2K1)
   04068 FoxO signaling pathway
    100667623 (MAP2K1)
   04072 Phospholipase D signaling pathway
    100667623 (MAP2K1)
   04071 Sphingolipid signaling pathway
    100667623 (MAP2K1)
   04024 cAMP signaling pathway
    100667623 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    100667623 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    100667623 (MAP2K1)
   04150 mTOR signaling pathway
    100667623 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100667623 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100667623 (MAP2K1)
   04210 Apoptosis
    100667623 (MAP2K1)
   04218 Cellular senescence
    100667623 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100667623 (MAP2K1)
   04540 Gap junction
    100667623 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100667623 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100667623 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100667623 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    100667623 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    100667623 (MAP2K1)
   04660 T cell receptor signaling pathway
    100667623 (MAP2K1)
   04662 B cell receptor signaling pathway
    100667623 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    100667623 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    100667623 (MAP2K1)
   04062 Chemokine signaling pathway
    100667623 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100667623 (MAP2K1)
   04929 GnRH secretion
    100667623 (MAP2K1)
   04912 GnRH signaling pathway
    100667623 (MAP2K1)
   04915 Estrogen signaling pathway
    100667623 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    100667623 (MAP2K1)
   04917 Prolactin signaling pathway
    100667623 (MAP2K1)
   04921 Oxytocin signaling pathway
    100667623 (MAP2K1)
   04926 Relaxin signaling pathway
    100667623 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    100667623 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    100667623 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    100667623 (MAP2K1)
   04916 Melanogenesis
    100667623 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100667623 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    100667623 (MAP2K1)
   04726 Serotonergic synapse
    100667623 (MAP2K1)
   04720 Long-term potentiation
    100667623 (MAP2K1)
   04730 Long-term depression
    100667623 (MAP2K1)
   04722 Neurotrophin signaling pathway
    100667623 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100667623 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100667623 (MAP2K1)
   05206 MicroRNAs in cancer
    100667623 (MAP2K1)
   05205 Proteoglycans in cancer
    100667623 (MAP2K1)
   05230 Central carbon metabolism in cancer
    100667623 (MAP2K1)
   05231 Choline metabolism in cancer
    100667623 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100667623 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100667623 (MAP2K1)
   05212 Pancreatic cancer
    100667623 (MAP2K1)
   05225 Hepatocellular carcinoma
    100667623 (MAP2K1)
   05226 Gastric cancer
    100667623 (MAP2K1)
   05214 Glioma
    100667623 (MAP2K1)
   05216 Thyroid cancer
    100667623 (MAP2K1)
   05221 Acute myeloid leukemia
    100667623 (MAP2K1)
   05220 Chronic myeloid leukemia
    100667623 (MAP2K1)
   05218 Melanoma
    100667623 (MAP2K1)
   05211 Renal cell carcinoma
    100667623 (MAP2K1)
   05219 Bladder cancer
    100667623 (MAP2K1)
   05215 Prostate cancer
    100667623 (MAP2K1)
   05213 Endometrial cancer
    100667623 (MAP2K1)
   05224 Breast cancer
    100667623 (MAP2K1)
   05223 Non-small cell lung cancer
    100667623 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100667623 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    100667623 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    100667623 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100667623 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100667623 (MAP2K1)
   05135 Yersinia infection
    100667623 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100667623 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    100667623 (MAP2K1)
   05161 Hepatitis B
    100667623 (MAP2K1)
   05160 Hepatitis C
    100667623 (MAP2K1)
   05164 Influenza A
    100667623 (MAP2K1)
   05163 Human cytomegalovirus infection
    100667623 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100667623 (MAP2K1)
   05165 Human papillomavirus infection
    100667623 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100667623 (MAP2K1)
   01522 Endocrine resistance
    100667623 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100667623 (MAP2K1)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100667623 (MAP2K1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE7 family
   100667623 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 DUF1827
Other DBs
NCBI-GeneID: 100667623
NCBI-ProteinID: XP_023414152
LinkDB
Position
Unknown
AA seq 404 aa
MPKKKPTPIQLNPAPDGSAVNGTTSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKVRPLKKEILEAPIFGAHLKSSFH
QLLQPTLVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKV
SIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSY
MSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCHVEGDAAETPPR
PRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAER
ADLKQLMVHTFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctcggcggtg
aacgggaccacctcggcggagaccaacctggaggccttgcagaagaagctggaggagcta
gaacttgatgaacagcagcggaagcgcctcgaggcctttcttacccagaaacagaaggtg
ggcgagctgaaggatgacgactttgagaagatcagcgagctgggtgctggcaatggcggc
gtggtgttcaaggtctctcacaagccgtctggcctggtcatggccagaaaggtgaggcca
cttaaaaaagaaattctggaagcacccatcttcggtgcccacctcaagtccagctttcac
cagctgctgcagcccacactggttctgcatgagtgtaactccccatacatcgtgggcttc
tacggtgcattctacagcgatggcgagatcagcatctgcatggagcacatggatgggggt
tccttggatcaagtcctgaagaaagctggaagaattcccgaacaaattttaggaaaagtt
agcattgctgtaataaagggactgacttacctgagggagaagcacaagataatgcacaga
gatgtcaagccctccaacatcctggtgaactcccgtggggagatcaagctatgtgacttt
ggggtcagtgggcagctcatcgactccatggctaactccttcgtgggcaccaggtcctac
atgtcgccagaaagactccaggggacccactattctgtgcagtcggacatctggagcatg
gggctctctcttgtggagatggcagttgggaggtaccccatccctcctccagatgccaag
gagctggagctgatgtttgggtgccatgtggagggagatgcagctgagacaccgcccagg
ccaaggacccctgggaggccgctcagctcttatggaatggacagccgacctcccatggcg
atttttgagttgttggattacatagttaacgagcctcctccaaaacttcccagtggagta
ttcagtctggaattccaagattttgtgaataaatgcctaatcaaaaaccccgcagagaga
gcagatttgaagcaactcatggttcacacgtttatcaagagatctgatgctgaagaagtg
gattttgccggttggctctgctccaccatcggccttaaccagcccagcacaccaacgcac
gcagctggcgtctaa

DBGET integrated database retrieval system