KEGG   Loxodonta africana (African savanna elephant): 100657649
Entry
100657649         CDS       T04351                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04330  Notch signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100657649 (DVL1)
   04330 Notch signaling pathway
    100657649 (DVL1)
   04390 Hippo signaling pathway
    100657649 (DVL1)
   04150 mTOR signaling pathway
    100657649 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100657649 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100657649 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100657649 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100657649 (DVL1)
   05226 Gastric cancer
    100657649 (DVL1)
   05217 Basal cell carcinoma
    100657649 (DVL1)
   05224 Breast cancer
    100657649 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100657649 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    100657649 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100657649 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100657649 (DVL1)
SSDB
Motif
Pfam: Dsh_C Dishevelled PDZ DEP PDZ_6 PDZ_2 Shufflon_N
Other DBs
NCBI-GeneID: 100657649
NCBI-ProteinID: XP_023407926
LinkDB
Position
Unknown
AA seq 613 aa
MDNETGAESMVSHRRERARRRNCEGREDASRTNGHPRAERRRDLGLPHDSASTVMSSELE
SSSFIDSDEEDTSRFMRDPCVHLCVCWRVPGPVVCTHRELSLPSKPVPGSAQPGGARLSS
STEQSTSSRLIRKHKRRRRRQRMRQTDRASSFSSITDSTMSLNIITVTLNMERHHFLGIS
IVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMTNDDAVRVLREIV
SQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSA
VTRTSSSSLTSSVPGAPQLEEAPLTVKSDMGAVVRVMRLPDSGLEIRDRMWLKITIANAV
IGADVVDWLYAHVEGFKERREARRYASTMLKHGFLRHTVNKVTFSEQCYYVFGDLCSNLA
ALNLNNGSSGASDQDTLAPLPHPAAPWPLGQAFPYQYPGPPPCFPPAYQDPGFSYGSGSA
GSQQSEGSKSSESTRSTGGSSRRALGREQERRAAGAGGSGSELDPTVPSGAGGWRERPAS
QLSRGSSPRSQASAAAPGLPPLCPLAKAYAAVGGPPGGPPVRELASVPPELTGSRQSFQK
AMGNPCEFFVDIM
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggacaatgagaccggcgcagagtccatggtcagccaccggcgggagcgagcccggcgc
cggaactgtgagggccgcgaggacgcctcccggaccaatgggcacccgagggcagagcgg
cggcgggatcttggcctgccccatgacagcgcatctactgtgatgagcagtgagctggaa
tccagcagcttcattgactcagacgaggaggacaccagccggttcatgagggatccatgt
gtgcacctgtgtgtgtgttggcgtgttccaggcccagtggtgtgtacacacagggagctg
agccttccgagcaaacctgtcccaggctctgcccagccaggtggagcaaggctgagcagc
tccacggagcagagcacttcttcgcggttgatccgcaaacacaagcggcggcgacggcgg
cagcgcatgcgccagacagaccgagcctcttccttcagcagcatcacagactcgaccatg
tcactgaacatcatcaccgtcacactcaacatggagaggcaccatttcctggggatcagc
atcgtgggccagagcaacgaccgtggcgatggcggcatctacattggctccatcatgaag
ggtggggctgtggccgccgatggccgcattgagccgggcgacatgctgctgcaggtgaat
gatgtcaactttgagaacatgaccaatgatgatgcagtccgtgtgctgcgggagatcgtg
tcacagaccgggcccattagcctcacggtggccaagtgctgggacccaaccccccggagc
tacttcaccatcccgagggctgaccctgtgcggcccatcgaccccgccgcctggctgtcc
cacacagcagcgctgacgggcgccctgccccgctacggtacgagcccctgctccagtgcc
gtcacacgtaccagctcctcctcactaacgagctctgtgcccggcgctccacagctggag
gaggcgccgctgacagtgaagagtgatatgggtgccgtcgtgcgggtcatgcggctaccg
gactcggggctggagatccgtgaccgcatgtggctcaagatcaccattgccaacgccgtt
attggcgcagacgtggtggactggctgtatgcacatgtggagggcttcaaggagcgacgc
gaagcacgaaggtatgccagcaccatgctgaagcatgggtttctgcggcatacagtcaac
aaggtcaccttctcagagcagtgctactacgtcttcggggacctgtgcagcaacctcgca
gccctgaacctcaacaacggctccagtggggcttcggatcaggacaccctggccccgctg
ccccacccagctgccccttggcccctgggccaggccttcccctatcagtaccctgggccc
ccaccctgcttcccacctgcctaccaggaccctggcttcagctatggcagcggcagcgcc
ggtagtcaacagagtgaaggaagcaagagcagcgagtccacccggagcaccggcgggagt
agccggcgggccttggggcgtgagcaggagcgccgggcagctggcgcagggggcagcggc
agtgagctggaccccacagtgccaagtggggcgggtggctggcgggagcgcccggccagc
cagctcagccgtggcagcagccctcgcagccaggcttcagctgccgcacctggtctgcct
cccctgtgccccctggccaaggcatatgcggcagtgggtgggccccctgggggaccgcct
gtgcgggagttggcgtcagtgcctcccgagctcacgggcagccgccagtccttccagaag
gccatggggaacccctgcgagttcttcgttgacatcatgtga

KEGG   Loxodonta africana (African savanna elephant): 100657749
Entry
100657749         CDS       T04351                                 

Gene name
DVL2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04330  Notch signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100657749 (DVL2)
   04330 Notch signaling pathway
    100657749 (DVL2)
   04390 Hippo signaling pathway
    100657749 (DVL2)
   04150 mTOR signaling pathway
    100657749 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100657749 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100657749 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100657749 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100657749 (DVL2)
   05226 Gastric cancer
    100657749 (DVL2)
   05217 Basal cell carcinoma
    100657749 (DVL2)
   05224 Breast cancer
    100657749 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100657749 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100657749 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100657749 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100657749 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100657749
NCBI-ProteinID: XP_003416931
LinkDB
Position
Unknown
AA seq 736 aa
MAGSGAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPAHEPRTDLVPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGGGGHRPS
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEPGPAGDGGPPPSRGSSGGPPNLRA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPIRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgggcagcggcgcggggggcggtggtgtcggggagacgaaggtgatttaccacttg
gatgaggaagagactccctatctagtgaagatccccgtccccgctgagcgcatcaccctc
ggcgatttcaagagcgtcctgcagcggcccgcgggagccaagtactttttcaagtctatg
gatcaggatttcggagtggtgaaggaagaaatttccgacgacaatgctcgccttccttgc
ttcaacggaagggtggtgtcctggctagtgtcatcagataacccccaacccgagatggct
cccccagcccatgagcctcgcacagacctggtgcctccacctccaccactaccccctttg
ccaccggagaggaccagtggcattggggactccaggcctccatctttccaccctaacgtc
tccagcagccgtgaaaacctggagccagagacagaaacagagtcagtcgtgtctctgagg
cgggagcggcctcgtaggagagacagcagtgagcacggcggtgggggccacaggcccagt
ggcccctcgaggctggagcgccacctagcagggtatgagagttcttccaccctgatgacc
agtgagctggagagcaccagcctgggggactcagatgaggatgacaccatgagcaggttc
agcagctccacggagcagagcagtgcctcccgcctcctcaagcgccaccggcggcggagg
aaacagcgaccgccccgcctggagaggacctcatctttcagcagtgtcactgactccaca
atgtctcttaacatcatcacagtcacactcaacatggagaagtacaacttcctgggcatc
tccattgtgggccagagcaatgagcggggagacggtggcatctacatcggctccattatg
aagggtggggcggtggcagctgatgggcgcattgagcctggagacatgcttttacaggtg
aatgacatgaattttgagaacatgagcaacgatgatgcagtgcgggtgctgagggacatc
gtacacaagccaggccccattgtgctgactgtggccaagtgttgggatccctctccgcaa
gcctacttcacactcccccgaaatgagcctatccagccgattgatcctgctgcctgggtc
tcccactctgctgcgctgactggcaccttcccagcctatccaggctcctcatctatgagc
accattacatctggttcgtctctgcctgacggctgtgagggccggggtctctccatccat
acagacatggcgtctgtgaccaaggccatggcagctccagagtctggcctggaagttcga
gaccgcatgtggctcaagatcaccatcccgaatgcctttctgggctctgacgtggttgac
tggctctaccatcacgtggagggctttcccgaacggcgggaggcccgcaagtatgctagt
gggctgctcaaggcaggcctcattcggcacaccgtcaacaagatcaccttctctgaacag
tgctactatgtctttggagacctcagtggcggctgtgagagctatctagtcaacctgtct
ttgaatgacaacgatggctccagcggggcttcggaccaggacaccttggctcctctgcct
ggggccaccccctggcccttgttgcctactttctcctaccagtacccagcaccccaccca
tacagcccccagcccccaccctaccatgagctgtcctcctacacctatggtgggggcagt
gccagcagccagcacagtgagggaagccggagcagtgggtcaacacgaagcgatggtggg
gcagggcgcacggggaggcctgaggagcgggcccccgagtccaaatctggcagcggcagt
gagtctgagccctccagccgggggggcagtcttcgacggggcggggaacctggcccagct
ggtgatgggggtcctcccccatccaggggctcgtcagggggtccccccaatcttcgagcc
cacccagggctccatccctatggaccacccccaggcatggccctcccctataaccccatg
atggtggtcatgatgcccccacccccaccccctgtccccccagcagtgcagcccccgggg
gcccctcccatcagagacctgggctctgtgccccctgagctgacagccagccgccaaagc
ttccatatggccatgggcaaccccagtgagttctttgtggatgtgatgtag

KEGG   Loxodonta africana (African savanna elephant): 100673586
Entry
100673586         CDS       T04351                                 

Gene name
DVL3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04150  mTOR signaling pathway
lav04310  Wnt signaling pathway
lav04330  Notch signaling pathway
lav04390  Hippo signaling pathway
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04916  Melanogenesis
lav04934  Cushing syndrome
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05165  Human papillomavirus infection
lav05200  Pathways in cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100673586 (DVL3)
   04330 Notch signaling pathway
    100673586 (DVL3)
   04390 Hippo signaling pathway
    100673586 (DVL3)
   04150 mTOR signaling pathway
    100673586 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100673586 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100673586 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100673586 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100673586 (DVL3)
   05226 Gastric cancer
    100673586 (DVL3)
   05217 Basal cell carcinoma
    100673586 (DVL3)
   05224 Breast cancer
    100673586 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100673586 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    100673586 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100673586 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100673586 (DVL3)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100673586
NCBI-ProteinID: XP_003412931
LinkDB
Position
Unknown
AA seq 709 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFGADNPSELPPAMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDAPEHTTRINGTSKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQPSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRDRAPSERSGPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPP
LYGPPVLMMAPPPAAMGPPGAPHRPRSGLCAPRTDRQQTVLPHGHGKPQ
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacctggatgggcaggagacgccgtacctggtgaag
ctgccgctgcccgccgagcgcgtcaccctggccgacttcaagggcgtgctgcagcgaccc
agctacaagttcttcttcaagtcgatggacgacgatttcggagtggtgaaggaggagatc
tctgatgacaatgccaagttaccctgcttcaatggccgtgtggtgtcctggctggtgtcc
gctgagggctcacacccagagccagcccccttcggtgctgacaacccatcagagctgcca
ccggccatggagcgcacagggggcattggggactcccggcccccatctttccaccctcat
gctggtgggggcagccaggagaacctggacaatgacacagaaacagactccttggtgtct
gcccagagggaacggccacgccggagggacgcccccgagcacacaacccggataaatgga
acttcaaagggggagcggcggcgggagccagggggatatgacagctcatccacccttatg
agtagcgagttggaaaccaccagcttctttgattccgacgaggatgactccaccagcagg
ttcagcagctccacggagcagagcagtgcctcacgcctgatgagaagacacaagcggcgg
cgacggaagcagaaggtgtcacggatcgagcggtcctcgtccttcagcagtatcacggac
tccaccatgtcgcttaacatcatcacggtcacactcaacatggaaaagtataacttcttg
ggcatctccattgtgggccaaagcaacgagcgtggtgacggaggcatctatatcggctcc
atcatgaagggtggggccgtggctgctgacggacgcatcgagcccggagacatgctgtta
caggtaaacgagatcaactttgagaacatgagtaacgacgacgcagtccgggtgctgcgt
gagattgtgcacaagccagggcccatcaccctgactgtagccaagtgctgggaccccagt
ccacgtggctgcttcacactgcccaggagtgaacccatccggcccatcgaccctgcggcc
tgggtctcccacaccgcagccatgactggcaccttccctgcctacggcatgagcccctcc
ctgagcaccatcacctccaccagctcctccatcaccagctccatccctgacacagaacgc
ctagacgacttccacctgtccatccacagtgacatggctgccattgtaaaagccatggcc
tcccctgaatccggcctggaggtccgcgaccgcatgtggctcaagatcaccatccccaat
gcgttcatcggctcggatgtggtggactggctataccacaacgtggaaggcttcactgac
aggcgggaggcccgcaagtatgccagcaacctgctgaaagccggcttcatccgccacacg
gtcaacaagatcaccttctccgagcagtgctactacatcttcggcgacctctgtggcaac
atggccaacctgtccctccatgaccacgatgggtccagtggcgcctctgaccaggacacg
ctggcccctttgccccaccctggggctgctccttggcccatggctttcccgtaccagtac
ccgccgcctccgcacccctacaacccacaccctggcttcccagagctggggtacagctat
ggtgggggcagcgccagtagtcagcccagtgaaggcagccggagcagcggctccaaccgc
agcggtagcgaccggcggaaggagaaggaccccaaggccggggactccaagtcaggcggg
agcggcagcgagtcggaccacacgacgcgcagcagcctgcgggggccccgggaccgcgcg
cccagtgagcgctcgggcccagcggccagcgaacacagccaccgcagccaccactcgctg
gccagcagcctgcgcagccatcacacgcacccgagctacgggccccccggcgtgcccccg
ctctacgggcccccagtgctgatgatggccccgccgcctgcggccatggggcccccaggg
gccccccacaggccgcgatctggcctctgtgccccccgaactgaccgccagcagacagtc
cttccgcatggccatgggaaaccccagtga

DBGET integrated database retrieval system