KEGG   Loxodonta africana (African savanna elephant): 100657698
Entry
100657698         CDS       T04351                                 

Gene name
PIDD1
Definition
(RefSeq) p53-induced death domain-containing protein 1 isoform X1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04064  NF-kappa B signaling pathway
lav04115  p53 signaling pathway
lav04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100657698 (PIDD1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100657698 (PIDD1)
   04115 p53 signaling pathway
    100657698 (PIDD1)
SSDB
Motif
Pfam: LRR_8 Death LRR_4 ZU5 LRR_9 Peptidase_S68
Other DBs
NCBI-GeneID: 100657698
NCBI-ProteinID: XP_010600662
LinkDB
Position
Unknown
AA seq 886 aa
MAAAVEGLEPEAAAEDATRGAAEEAVDAGLRVPPLLAGNRLNLDLYPGGCHQLLHLCAQR
SPQLLQVEFLRLSTHEDPGLLGATLAQVPGRLPCLRSLVLKGGQHRDALGACLRGCLTSL
PDGLSNLARLAHLDLSFNSLEALPACVPQLRGLDALLLSHNCLLELPEALGALPSLTFLA
VTHNCLQTLPTALGALSTLRRLDLSENLLDTLPPEIGGLSSLAELNLASNRLQSLPASLA
GLRSLRLLFLYSNLLTSVPAGLIHLPLLARLDLRGNQLRDVPPEFLDAPFVRLQGNPLGE
ALPRPLSPPGTPVVPEMPRLFLTTDLDSFPVTPQGCSVTLACGIRLHFPAGATATPITIH
YRLWLPEPRLVPLGPHDTLLSHVLELQPHGVVFQQDVGLWLLFVPPRVRRYREVVVRTLS
EDSWTDLETHLEEEAPKRERCSAPQDIPGSRSRSPRGPPRSLARSECRWYTWASRELRAL
LGEPEAAVSPLLCLWQSGPPSFLRPVTVQLPLPPGITGLTLDRSRLHLLYQAPPVATWDD
ITAQVALELTHLYARFQVTHFSWYWLWYTTKSCVGGLARKAWARLRLHRVNLIALQRRRD
PEQVLLQCLPRNKVEATLKRLLERYHGPEPSDTVELFEGEKFFAAFERGIDVDADRPDCV
EGRICFVFYSHLKNVKEVYVTTALDREAQAVRGQVSFYRGTVPTEVPKEAEAARQKKGLD
ALWMATLPIKLPRLRGSEGTGQGLGAGLSLAPLNLGDAESGFLTQSNLLSVARRLGLDWP
AVALHLGLPYRELQRIRLEFRDDLDGQIRHMLFSWAERQAGRPGAVGLLVQALEQSDRRD
LAEEVRAVLELGRQKYQAGILRTGLAPGDPAPPSPSASESRESTEA
NT seq 2661 nt   +upstreamnt  +downstreamnt
atggctgcagcggtggaggggctggagcccgaggcagctgcagaagatgcgacaagaggt
gctgcagaggaggctgtggacgcagggctcagggtgccacctcttctggccgggaaccgc
ctgaacctggacctgtaccctgggggctgccaccagctgctgcacctgtgcgcccagcgg
tcccctcagctgctgcaggtggagttccttcggctgagcacccacgaggaccctgggctg
ctgggagccaccctggcccaggtgccaggcagactgccctgcctccgctccctggttctc
aaaggtgggcaacaccgggatgcactgggtgcctgccttcggggctgtctcacttctctg
cccgacggcctgagcaacctggctcgcctggcccatttggacctgagcttcaacagtctg
gaggcactaccagcgtgcgttccccagcttcgtggcctggatgctctcttgctctctcac
aactgcctcttggagctgcctgaggccctgggagccctcccctccctcaccttccttgct
gtgacccacaactgcctgcaaacgctgcctacagcgctgggggccctgtctaccctgagg
cgccttgatctctctgagaaccttctggacacgctgccccctgagattggaggcctgagc
agccttgctgagctcaacctggcctccaaccggctgcagagcctcccagcctcccttgcg
gggctgcggtccttgcggctccttttcctgtatagcaaccttctgacctcggtgcccgct
ggccttatccacctccctctgctcgcccggcttgacctgaggggcaaccagctgcgggac
gtgccccctgagttcctggatgctccctttgtgcggctccaggggaaccccctgggcgag
gccctgccgagacccctgagccccccagggacacctgtagttccggaaatgcccaggctg
ttcctgaccacagatttggacagcttcccagtgaccccccaaggctgctctgtgaccctg
gcctgcggcattcggctacatttccctgcaggagccaccgccacccccatcaccatccac
tatcgactgtggctgccggagcctcgcttggtgcccctggggcctcacgacactcttctc
agccatgtcctggagctgcagcctcacggggtggtcttccagcaggatgtgggcttgtgg
ttgctcttcgtgcccccgagggtccggcgttaccgcgaggtggtggtcagaaccctgagt
gaagacagctggaccgacctggagacccatctggaagaggaggctcccaagagggaacgc
tgctctgctcctcaggacatcccggggtcaaggtcacgttcccccagggggccaccgagg
agcctcgccaggtccgaatgcaggtggtacacatgggccagccgtgagctgcgagcgctg
ttgggggagcctgaggcagctgtgagccccctgctgtgcctctggcagagtggacccccc
agcttcctccggcctgtcactgtgcagctgcctctgcctcctggcatcacaggcctgact
ctggaccgctcccgcctgcacctgttgtaccaggcccctcctgtggccacctgggatgac
atcacggctcaggtggccctagagcttacacacctgtatgcccgcttccaggtcacacac
ttttcctggtactggctctggtacaccactaagagctgtgtgggcggcctggcgcgcaag
gcctgggcacggctgcggctgcaccgtgtgaacctcatcgcgctacagagacgccgggac
cctgagcaggtcctgctgcagtgcctgccccgcaacaaggtggaagccactctgaagcgg
ctgttggagcggtaccatggccccgagccctcagataccgtggagctctttgagggcgaa
aagttctttgctgcctttgagcgcggcattgacgtggatgccgatcgtccagactgtgtg
gagggcaggatctgctttgtcttctattctcacctgaaaaatgtgaaggaggtgtatgta
accactgccttggaccgggaggctcaggctgtgcggggccaggtgtccttctaccggggc
acagtgcccacagaggtccctaaagaggcggaggcggcgcggcagaagaagggcttggac
gccctgtggatggccaccctgcccatcaagctgccgagactgcgggggtctgaggggacg
gggcaggggctgggggcaggcctctccctggcacctctgaacctcggtgatgccgagagc
ggcttcctgacccagagcaacttgctgagcgtggccaggcgcctgggccttgactggcca
gctgtggccctgcacctgggcctgccctaccgcgagctgcagcggatccggcttgagttc
cgggatgacctggacggccagatccgccacatgctcttctcctgggctgagaggcaggct
gggcggccaggcgcggtggggctcctggtgcaggccctggagcagagtgaccggagagac
ttggctgaggaggtgcgggcggtcttggagcttggtcgccaaaagtaccaggccggcatc
ctccgcacaggcctggcccccggggacccagccccacccagcccttcagcatcagagtcc
cgagagtccaccgaggcctaa

DBGET integrated database retrieval system