KEGG   Loxodonta africana (African savanna elephant): 100657715
Entry
100657715         CDS       T04351                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6 isoform X1
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04010  MAPK signaling pathway
lav04060  Cytokine-cytokine receptor interaction
lav04115  p53 signaling pathway
lav04210  Apoptosis
lav04217  Necroptosis
lav04650  Natural killer cell mediated cytotoxicity
lav04668  TNF signaling pathway
lav04932  Non-alcoholic fatty liver disease
lav04940  Type I diabetes mellitus
lav05010  Alzheimer disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05142  Chagas disease
lav05143  African trypanosomiasis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05205  Proteoglycans in cancer
lav05320  Autoimmune thyroid disease
lav05330  Allograft rejection
lav05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100657715 (FAS)
   04668 TNF signaling pathway
    100657715 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100657715 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100657715 (FAS)
   04217 Necroptosis
    100657715 (FAS)
   04115 p53 signaling pathway
    100657715 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100657715 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100657715 (FAS)
   05205 Proteoglycans in cancer
    100657715 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100657715 (FAS)
   05330 Allograft rejection
    100657715 (FAS)
   05332 Graft-versus-host disease
    100657715 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100657715 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100657715 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100657715 (FAS)
   04932 Non-alcoholic fatty liver disease
    100657715 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100657715 (FAS)
   05161 Hepatitis B
    100657715 (FAS)
   05160 Hepatitis C
    100657715 (FAS)
   05164 Influenza A
    100657715 (FAS)
   05162 Measles
    100657715 (FAS)
   05168 Herpes simplex virus 1 infection
    100657715 (FAS)
   05163 Human cytomegalovirus infection
    100657715 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100657715 (FAS)
   05169 Epstein-Barr virus infection
    100657715 (FAS)
   05165 Human papillomavirus infection
    100657715 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100657715 (FAS)
   05143 African trypanosomiasis
    100657715 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100657715 (FAS)
Cytokine receptors [BR:lav04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100657715 (FAS)
CD molecules [BR:lav04090]
 Proteins
  100657715 (FAS)
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 100657715
NCBI-ProteinID: XP_010587427
LinkDB
Position
Unknown
AA seq 327 aa
MPGFWILLSLIFTLIAGNDNAGATAINFEGSKLRRNITKRDYRCGEDLHLASQNHDSHLC
CQLCPAGTWKTADCKDNEGHPSCTPCKEGQEYTEEKNYLDYCRRCDFCDEEHGLEVEKNC
TRTQNTKCRCKANFFCNGSSCDLCEPCITCEHGIIEKCTPTSNTKCKGKESGSNLPWLLC
LLVIPIILAIIWGWLKYKKGNAETPEKSKSTEMEPLNFRDVDLSKYITSIAELMTLNQVK
EFVRKNGMKEPKMDEIKNNHPQDTAEQKVQLLRNWYQHHGKKGAYDALIKSLPKDIAEKV
QDMVQKDITSNDENADFKSENERQSMA
NT seq 984 nt   +upstreamnt  +downstreamnt
atgccggggttctggatcctcctgtctctgatattcacattgattgctggaaacgataat
gccggagcgactgccatcaactttgaagggtcaaaattgaggaggaatattacaaaaagg
gattatagatgcggggaagacctgcatcttgcatcccaaaatcatgacagccacctgtgc
tgtcagttatgtcctgctggcacatggaaaactgctgactgcaaagacaatgaaggacac
cctagctgtacgccctgcaaagaagggcaggagtacacagaagagaaaaattatttagat
tactgccgcagatgtgacttttgtgatgaagaacatggcttagaagtggaaaaaaactgt
acccgaacccagaataccaagtgtagatgtaaagcaaactttttttgtaacggttcttca
tgcgacctctgtgaaccttgcatcacgtgtgaacatggaatcattgagaaatgcacacca
accagtaacactaaatgcaaaggaaaagaatctggatctaacttaccgtggttactgtgc
ctcctggtgattccaataattcttgcaataatttgggggtggttgaaatataaaaagggc
aatgcagaaacccctgagaagtctaaatctactgaaatggaaccactgaatttcagagat
gttgacttgagtaaatatatcacttctattgctgaactaatgacactaaatcaagttaaa
gaatttgttcgaaagaatggtatgaaagaacccaaaatggatgagatcaagaataaccat
cctcaagatacagctgaacaaaaagtccaactgctccggaattggtatcaacatcatggg
aagaaaggcgcgtacgatgctttgattaaaagcttaccaaaagatattgcagaaaaagtt
caggatatggttcaaaaggacattactagtaatgatgaaaacgcagacttcaaaagcgaa
aatgaacgacaaagcatggcctag

DBGET integrated database retrieval system